NFAT2 (NFATC1) (NM_172390) Human Tagged ORF Clone

CAT#: RC211136

Reviews ()
Write a review

NFATC1 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1 (NFATC1), transcript variant 1



  "NM_172390" in other vectors (6)

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 628.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name NFAT2 (NFATC1) (NM_172390) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NFATC1
Synonyms NF-ATC; NF-ATc1.2; NFAT2; NFATc
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC211136 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAAGCACCAGCTTTCCAGTCCCTTCCAAGTTTCCACTTGGCCCTGCGGCTGCGGTCTTCGGGAGAG
GAGAAACTTTGGGGCCCGCGCCGCGCGCCGGCGGCACCATGAAGTCAGCGGAGGAAGAACACTATGGCTA
TGCATCCTCCAACGTCAGCCCCGCCCTGCCGCTCCCCACGGCGCACTCCACCCTGCCGGCCCCGTGCCAC
AACCTTCAGACCTCCACACCGGGCATCATCCCGCCGGCGGATCACCCCTCGGGGTACGGGGCAGCTTTGG
ACGGTGGGCCCGCGGGCTACTTCCTCTCCTCCGGCCACACCAGGCCTGATGGGGCCCCTGCCCTGGAGAG
TCCTCGCATCGAGATAACCTCGTGCTTGGGCCTGTACCACAACAATAACCAGTTTTTCCACGATGTGGAG
GTGGAAGACGTCCTCCCTAGCTCCAAACGGTCCCCCTCCACGGCCACGCTGAGTCTGCCCAGCCTGGAGG
CCTACAGAGACCCCTCGTGCCTGAGCCCGGCCAGCAGCCTGTCCTCCCGGAGCTGCAACTCAGAGGCCTC
CTCCTACGAGTCCAACTACTCGTACCCGTACGCGTCCCCCCAGACGTCGCCATGGCAGTCTCCCTGCGTG
TCTCCCAAGACCACGGACCCCGAGGAGGGCTTTCCCCGCGGGCTGGGGGCCTGCACACTGCTGGGTTCCC
CGCGGCACTCCCCCTCCACCTCGCCCCGCGCCAGCGTCACTGAGGAGAGCTGGCTGGGTGCCCGCTCCTC
CAGACCCGCGTCCCCGTGCAACAAGAGGAAGTACAGCCTCAACGGCCGGCAGCCGCCCTACTCACCCCAC
CACTCGCCCACGCCGTCCCCGCACGGCTCCCCGCGGGTCAGCGTGACCGACGACTCGTGGTTGGGCAACA
CCACCCAGTACACCAGCTCGGCCATCGTGGCCGCCATCAACGCGCTGACCACCGACAGCAGCCTGGACCT
GGGAGATGGCGTCCCTGTCAAGTCCCGCAAGACCACCCTGGAGCAGCCGCCCTCAGTGGCGCTCAAGGTG
GAGCCCGTCGGGGAGGACCTGGGCAGCCCCCCGCCCCCGGCCGACTTCGCGCCCGAAGACTACTCCTCTT
TCCAGCACATCAGGAAGGGCGGCTTCTGCGACCAGTACCTGGCGGTGCCGCAGCACCCCTACCAGTGGGC
GAAGCCCAAGCCCCTGTCCCCTACGTCCTACATGAGCCCGACCCTGCCCGCCCTGGACTGGCAGCTGCCG
TCCCACTCAGGCCCGTATGAGCTTCGGATTGAGGTGCAGCCCAAGTCCCACCACCGAGCCCACTACGAGA
CGGAGGGCAGCCGGGGGGCCGTGAAGGCGTCGGCCGGAGGACACCCCATCGTGCAGCTGCATGGCTACTT
GGAGAATGAGCCGCTGATGCTGCAGCTTTTCATTGGGACGGCGGACGACCGCCTGCTGCGCCCGCACGCC
TTCTACCAGGTGCACCGCATCACAGGGAAGACCGTGTCCACCACCAGCCACGAGGCCATCCTCTCCAACA
CCAAAGTCCTGGAGATCCCACTCCTGCCGGAGAACAGCATGCGAGCCGTCATTGACTGTGCCGGAATCCT
GAAACTCAGAAACTCCGACATTGAACTTCGGAAAGGAGAGACGGACATCGGGAGGAAGAACACACGGGTA
CGGCTGGTGTTCCGCGTTCACGTCCCGCAACCCAGCGGCCGCACGCTGTCCCTGCAGGTGGCCTCCAACC
CCATCGAATGCTCCCAGCGCTCAGCTCAGGAGCTGCCTCTGGTGGAGAAGCAGAGCACGGACAGCTATCC
GGTCGTGGGCGGGAAGAAGATGGTCCTGTCTGGCCACAACTTCCTGCAGGACTCCAAGGTCATTTTCGTG
GAGAAAGCCCCAGATGGCCACCATGTCTGGGAGATGGAAGCGAAAACTGACCGGGACCTGTGCAAGCCGA
ATTCTCTGGTGGTTGAGATCCCGCCATTTCGGAATCAGAGGATAACCAGCCCCGTTCACGTCAGTTTCTA
CGTCTGCAACGGGAAGAGAAAGCGAAGCCAGTACCAGCGTTTCACCTACCTTCCCGCCAACGGTAACGCC
ATCTTTCTAACCGTAAGCCGTGAACATGAGCGCGTGGGGTGCTTTTTC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC211136 protein sequence
Red=Cloning site Green=Tags(s)

MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPTAHSTLPAPCH
NLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVE
VEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCV
SPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPH
HSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKV
EPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLP
SHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHA
FYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRV
RLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFV
EKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANGNA
IFLTVSREHERVGCFF

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_172390
ORF Size 2148 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_172390.3
RefSeq Size 2978 bp
RefSeq ORF 2151 bp
Locus ID 4772
UniProt ID O95644, A8K9C6
Cytogenetics 18q23
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Axon guidance, B cell receptor signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway
MW 77.8 kDa
Gene Summary The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Different isoforms of this protein may regulate inducible expression of different cytokine genes. [provided by RefSeq, Jul 2013]

Other Versions

Other products for "NFATC1"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 150.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Mouse Monoclonal anti-NFATc1 Antibody
    • 100 ug

USD 385.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 135.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools