NFAT2(NFATC1) (NM_172390) Human Tagged ORF Clone

CAT#: RG211136

NFATC1 (GFP-tagged) - Human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1 (NFATC1), transcript variant 1

Change vector?

  • TrueORF®

USD 629


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name NFAT2(NFATC1) (NM_172390) Human Tagged ORF Clone
Symbol NFATC1
Synonyms NF-ATC; NF-ATc1.2; NFAT2; NFATc
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG211136 representing NM_172390
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAAGCACCAGCTTTCCAGTCCCTTCCAAGTTTCCACTTGGCCCTGCGGCTGCGGTCTTCGGGAGAG
GAGAAACTTTGGGGCCCGCGCCGCGCGCCGGCGGCACCATGAAGTCAGCGGAGGAAGAACACTATGGCTA
TGCATCCTCCAACGTCAGCCCCGCCCTGCCGCTCCCCACGGCGCACTCCACCCTGCCGGCCCCGTGCCAC
AACCTTCAGACCTCCACACCGGGCATCATCCCGCCGGCGGATCACCCCTCGGGGTACGGGGCAGCTTTGG
ACGGTGGGCCCGCGGGCTACTTCCTCTCCTCCGGCCACACCAGGCCTGATGGGGCCCCTGCCCTGGAGAG
TCCTCGCATCGAGATAACCTCGTGCTTGGGCCTGTACCACAACAATAACCAGTTTTTCCACGATGTGGAG
GTGGAAGACGTCCTCCCTAGCTCCAAACGGTCCCCCTCCACGGCCACGCTGAGTCTGCCCAGCCTGGAGG
CCTACAGAGACCCCTCGTGCCTGAGCCCGGCCAGCAGCCTGTCCTCCCGGAGCTGCAACTCAGAGGCCTC
CTCCTACGAGTCCAACTACTCGTACCCGTACGCGTCCCCCCAGACGTCGCCATGGCAGTCTCCCTGCGTG
TCTCCCAAGACCACGGACCCCGAGGAGGGCTTTCCCCGCGGGCTGGGGGCCTGCACACTGCTGGGTTCCC
CGCGGCACTCCCCCTCCACCTCGCCCCGCGCCAGCGTCACTGAGGAGAGCTGGCTGGGTGCCCGCTCCTC
CAGACCCGCGTCCCCGTGCAACAAGAGGAAGTACAGCCTCAACGGCCGGCAGCCGCCCTACTCACCCCAC
CACTCGCCCACGCCGTCCCCGCACGGCTCCCCGCGGGTCAGCGTGACCGACGACTCGTGGTTGGGCAACA
CCACCCAGTACACCAGCTCGGCCATCGTGGCCGCCATCAACGCGCTGACCACCGACAGCAGCCTGGACCT
GGGAGATGGCGTCCCTGTCAAGTCCCGCAAGACCACCCTGGAGCAGCCGCCCTCAGTGGCGCTCAAGGTG
GAGCCCGTCGGGGAGGACCTGGGCAGCCCCCCGCCCCCGGCCGACTTCGCGCCCGAAGACTACTCCTCTT
TCCAGCACATCAGGAAGGGCGGCTTCTGCGACCAGTACCTGGCGGTGCCGCAGCACCCCTACCAGTGGGC
GAAGCCCAAGCCCCTGTCCCCTACGTCCTACATGAGCCCGACCCTGCCCGCCCTGGACTGGCAGCTGCCG
TCCCACTCAGGCCCGTATGAGCTTCGGATTGAGGTGCAGCCCAAGTCCCACCACCGAGCCCACTACGAGA
CGGAGGGCAGCCGGGGGGCCGTGAAGGCGTCGGCCGGAGGACACCCCATCGTGCAGCTGCATGGCTACTT
GGAGAATGAGCCGCTGATGCTGCAGCTTTTCATTGGGACGGCGGACGACCGCCTGCTGCGCCCGCACGCC
TTCTACCAGGTGCACCGCATCACAGGGAAGACCGTGTCCACCACCAGCCACGAGGCCATCCTCTCCAACA
CCAAAGTCCTGGAGATCCCACTCCTGCCGGAGAACAGCATGCGAGCCGTCATTGACTGTGCCGGAATCCT
GAAACTCAGAAACTCCGACATTGAACTTCGGAAAGGAGAGACGGACATCGGGAGGAAGAACACACGGGTA
CGGCTGGTGTTCCGCGTTCACGTCCCGCAACCCAGCGGCCGCACGCTGTCCCTGCAGGTGGCCTCCAACC
CCATCGAATGCTCCCAGCGCTCAGCTCAGGAGCTGCCTCTGGTGGAGAAGCAGAGCACGGACAGCTATCC
GGTCGTGGGCGGGAAGAAGATGGTCCTGTCTGGCCACAACTTCCTGCAGGACTCCAAGGTCATTTTCGTG
GAGAAAGCCCCAGATGGCCACCATGTCTGGGAGATGGAAGCGAAAACTGACCGGGACCTGTGCAAGCCGA
ATTCTCTGGTGGTTGAGATCCCGCCATTTCGGAATCAGAGGATAACCAGCCCCGTTCACGTCAGTTTCTA
CGTCTGCAACGGGAAGAGAAAGCGAAGCCAGTACCAGCGTTTCACCTACCTTCCCGCCAACGGTAACGCC
ATCTTTCTAACCGTAAGCCGTGAACATGAGCGCGTGGGGTGCTTTTTC


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG211136 representing NM_172390
Red=Cloning site Green=Tags(s)

MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPTAHSTLPAPCH
NLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVE
VEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCV
SPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPH
HSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKV
EPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLP
SHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHA
FYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRV
RLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFV
EKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANGNA
IFLTVSREHERVGCFF

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_172390
ORF Size 2148 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_172390.1, NP_765978
RefSeq Size 3140
RefSeq ORF 2151
Locus ID 4772
Cytogenetics 18q23
Protein Families Transcription Factors, Druggable Genome
Protein Pathways Wnt signaling pathway, Axon guidance, VEGF signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, B cell receptor signaling pathway
Gene Summary The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Different isoforms of this protein may regulate inducible expression of different cytokine genes. [provided by RefSeq, Jul 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.