VCP (NM_007126) Human Tagged ORF Clone

CAT#: RC211130

Reviews ()
Write a review

VCP (Myc-DDK-tagged)-Human valosin containing protein (VCP)



  "NM_007126" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol VCP
Synonyms CDC48; FTDALS6; p97; TERA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC211130 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCTGGAGCCGATTCAAAAGGTGATGACCTATCAACAGCCATTCTCAAACAGAAGAACCGTCCCA
ATCGGTTAATTGTTGATGAAGCCATCAATGAGGACAACAGTGTGGTGTCCTTGTCCCAGCCCAAGATGGA
TGAATTGCAGTTGTTCCGAGGTGACACAGTGTTGCTGAAAGGAAAGAAGAGACGAGAAGCTGTTTGCATC
GTCCTTTCTGATGATACTTGTTCTGATGAGAAGATTCGGATGAATAGAGTTGTTCGGAATAACCTTCGTG
TACGCCTAGGGGATGTCATCAGCATCCAGCCATGCCCTGATGTGAAGTACGGCAAACGTATCCATGTGCT
GCCCATTGATGACACAGTGGAAGGCATTACTGGTAATCTCTTCGAGGTATACCTTAAGCCGTACTTCCTG
GAAGCGTATCGACCCATCCGGAAAGGAGACATTTTTCTTGTCCGTGGTGGGATGCGTGCTGTGGAGTTCA
AAGTGGTGGAAACAGATCCTAGCCCTTATTGCATTGTTGCTCCAGACACAGTGATCCACTGCGAAGGGGA
GCCTATCAAACGAGAGGATGAGGAAGAGTCCTTGAATGAAGTAGGGTATGATGACATTGGTGGCTGCAGG
AAGCAGCTAGCTCAGATAAAGGAGATGGTGGAACTGCCCCTGAGACATCCTGCCCTCTTTAAGGCAATTG
GTGTGAAGCCTCCTAGAGGAATCCTGCTTTACGGACCTCCTGGAACAGGAAAGACCCTGATTGCTCGAGC
TGTAGCAAATGAGACTGGAGCCTTCTTCTTCTTGATCAATGGTCCTGAGATCATGAGCAAATTGGCTGGT
GAGTCTGAGAGCAACCTTCGTAAAGCCTTTGAGGAGGCTGAGAAGAATGCTCCTGCCATCATCTTCATTG
ATGAGCTAGATGCCATCGCTCCCAAAAGAGAGAAAACTCATGGCGAGGTGGAGCGGCGCATTGTATCACA
GTTGTTGACCCTCATGGATGGCCTAAAGCAGAGGGCACATGTGATTGTTATGGCAGCAACCAACAGACCC
AACAGCATTGACCCAGCTCTACGGCGATTTGGTCGCTTTGACAGGGAGGTAGATATTGGAATTCCTGATG
CTACAGGACGCTTAGAGATTCTTCAGATCCATACCAAGAACATGAAGCTGGCAGATGATGTGGACCTGGA
ACAGGTAGCCAATGAGACTCACGGGCATGTGGGTGCTGACTTAGCAGCCCTGTGCTCAGAGGCTGCTCTG
CAAGCCATCCGCAAGAAGATGGATCTCATTGACCTAGAGGATGAGACCATTGATGCCGAGGTCATGAACT
CTCTAGCAGTTACTATGGATGACTTCCGGTGGGCCTTGAGCCAGAGTAACCCATCAGCACTGCGGGAAAC
CGTGGTAGAGGTGCCACAGGTAACCTGGGAAGACATCGGGGGCCTAGAGGATGTCAAACGTGAGCTACAG
GAGCTGGTCCAGTATCCTGTGGAGCACCCAGACAAATTCCTGAAGTTTGGCATGACACCTTCCAAGGGAG
TTCTGTTCTATGGACCTCCTGGCTGTGGGAAAACTTTGTTGGCCAAAGCCATTGCTAATGAATGCCAGGC
CAACTTCATCTCCATCAAGGGTCCTGAGCTGCTCACCATGTGGTTTGGGGAGTCTGAGGCCAATGTCAGA
GAAATCTTTGACAAGGCCCGCCAAGCTGCCCCCTGTGTGCTATTCTTTGATGAGCTGGATTCGATTGCCA
AGGCTCGTGGAGGTAACATTGGAGATGGTGGTGGGGCTGCTGACCGAGTCATCAACCAGATCCTGACAGA
AATGGATGGCATGTCCACAAAAAAAAATGTGTTCATCATTGGCGCTACCAACCGGCCTGACATCATTGAT
CCTGCCATCCTCAGACCTGGCCGTCTTGATCAGCTCATCTACATCCCACTTCCTGATGAGAAGTCCCGTG
TTGCCATCCTCAAGGCTAACCTGCGCAAGTCCCCAGTTGCCAAGGATGTGGACTTGGAGTTCCTGGCTAA
AATGACTAATGGCTTCTCTGGAGCTGACCTGACAGAGATTTGCCAGCGTGCTTGCAAGCTGGCCATCCGT
GAATCCATCGAGAGTGAGATTAGGCGAGAACGAGAGAGGCAGACAAACCCATCAGCCATGGAGGTAGAAG
AGGATGATCCAGTGCCTGAGATCCGTCGAGATCACTTTGAAGAAGCCATGCGCTTTGCGCGCCGTTCTGT
CAGTGACAATGACATTCGGAAGTATGAGATGTTTGCCCAGACCCTTCAGCAGAGTCGGGGCTTTGGCAGC
TTCAGATTCCCTTCAGGGAACCAGGGTGGAGCTGGCCCCAGTCAGGGCAGTGGAGGCGGCACAGGTGGCA
GTGTATACACAGAAGACAATGATGATGACCTGTATGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211130 protein sequence
Red=Cloning site Green=Tags(s)

MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCI
VLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFL
EAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCR
KQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAG
ESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRP
NSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL
QAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQ
ELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR
EIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIID
PAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIR
ESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGS
FRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007126
ORF Size 2418 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007126.5
RefSeq Size 3859 bp
RefSeq ORF 2421 bp
Locus ID 7415
UniProt ID P55072
Cytogenetics 9p13.3
Domains cdc48_N, AAA, AAA
MW 89.3 kDa
Gene Summary This gene encodes a member of the AAA ATPase family of proteins. The encoded protein plays a role in protein degradation, intracellular membrane fusion, DNA repair and replication, regulation of the cell cycle, and activation of the NF-kappa B pathway. This protein forms a homohexameric complex that interacts with a variety of cofactors and extracts ubiquitinated proteins from lipid membranes or protein complexes. Mutations in this gene cause IBMPFD (inclusion body myopathy with paget disease of bone and frontotemporal dementia), ALS (amyotrophic lateral sclerosis) and Charcot-Marie-Tooth disease in human patients. [provided by RefSeq, Aug 2017]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


Rabbit polyclonal anti-VCP Antibody
    • 100 ul

USD 380.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.