VPS26C (NM_006052) Human Tagged ORF Clone

CAT#: RC210755

Reviews ()
Write a review

DSCR3 (Myc-DDK-tagged)-Human Down syndrome critical region gene 3 (DSCR3)



  "NM_006052" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 300.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "VPS26C"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol VPS26C
Synonyms DCRA; DSCR3; DSCRA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210755 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGACCGCCCTGGACATCAAGATTAAAAGAGCGAATAAAGTTTATCACGCCGGGGAAGTGCTCTCTG
GCGTGGTGGTCATATCGAGTAAGGATTCAGTCCAACACCAGGGAGTGTCTTTGACCATGGAAGGAACTGT
AAACCTCCAGCTCAGTGCCAAAAGTGTGGGTGTGTTTGAAGCTTTTTATAATTCTGTTAAGCCTATCCAG
ATTATCAACAGCACCATAGAAATGGTGAAGCCGGGGAAATTTCCCAGCGGCAAAACAGAAATCCCTTTTG
AATTTCCTCTGCACTTGAAGGGTAACAAAGTTCTGTATGAGACGTATCATGGCGTGTTTGTCAACATTCA
GTATACACTGCGCTGTGACATGAAGCGGTCTCTGTTGGCCAAGGACTTGACAAAGACCTGTGAATTTATC
GTTCACTCCGCTCCTCAGAAGGGGAAGTTTACTCCCAGTCCCGTGGACTTCACGATTACACCTGAAACCT
TACAGAACGTCAAAGAGAGAGCTTTGCTTCCCAAATTTCTCCTTCGAGGACATCTCAACTCAACAAACTG
TGTCATCACGCAGCCACTAACGGGAGAGCTGGTGGTGGAGAGCTCGGAAGCCGCCATCAGAAGCGTGGAG
CTGCAGCTGGTGCGCGTGGAGACGTGCGGGTGTGCAGAAGGCTATGCCCGCGACGCCACGGAGATTCAGA
ACATTCAGATCGCCGACGGGGATGTGTGCAGGGGCCTCTCTGTCCCCATCTACATGGTCTTCCCTAGGCT
GTTCACCTGCCCTACACTGGAGACCACCAACTTCAAAGTGGAATTTGAGGTTAACATCGTGGTGCTGCTT
CACCCTGACCACCTCATCACGGAGAACTTCCCGCTGAAGCTCTGCAGGATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210755 protein sequence
Red=Cloning site Green=Tags(s)

MGTALDIKIKRANKVYHAGEVLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFEAFYNSVKPIQ
IINSTIEMVKPGKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFI
VHSAPQKGKFTPSPVDFTITPETLQNVKERALLPKFLLRGHLNSTNCVITQPLTGELVVESSEAAIRSVE
LQLVRVETCGCAEGYARDATEIQNIQIADGDVCRGLSVPIYMVFPRLFTCPTLETTNFKVEFEVNIVVLL
HPDHLITENFPLKLCRI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006052
ORF Size 891 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006052.2
RefSeq Size 3252 bp
RefSeq ORF 894 bp
Locus ID 10311
UniProt ID O14972
Cytogenetics 21q22.13
Domains Vps26
MW 33 kDa
Gene Summary The region of chromosome 21 between genes CBR and ERG (CBR-ERG region), which spans 2.5 Mb on 21q22.2, has been defined by analysis of patients with partial trisomy 21. It contributes significantly to the pathogenesis of many characteristics of Down syndrome, including morphological features, hypotonia, and cognitive disability. The DSCR3 (Down syndrome critical region gene 3) gene is found in this region and is predictated to contain eight exons. DSCR3 is expressed in most tissues examined. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Rabbit Polyclonal Anti-DSCR3 Antibody
    • 100 ul

USD 539.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.