RALY (NM_016732) Human Tagged ORF Clone

CAT#: RC210723

RALY (Myc-DDK-tagged)-Human RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) (RALY), transcript variant 1

Change vector?

USD 485


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name RALY (NM_016732) Human Tagged ORF Clone
Symbol RALY
Synonyms HNRPCL2; P542
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC210723 representing NM_016732
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTTGAAGCTTCAGGCAAGCAATGTAACCAACAAGAATGACCCCAAGTCCATCAACTCTCGAGTCT
TCATTGGAAACCTCAACACAGCTCTGGTGAAGAAATCAGATGTGGAGACCATCTTCTCTAAGTATGGCCG
TGTGGCCGGCTGTTCTGTGCACAAGGGCTATGCCTTTGTTCAGTACTCCAATGAGCGCCATGCCCGGGCA
GCTGTGCTGGGAGAGAATGGGCGGGTGCTGGCCGGGCAGACCCTGGACATCAACATGGCTGGAGAGCCTA
AGCCTGACAGACCCAAGGGGCTAAAGAGAGCAGCATCTGCCATATACAGTGGCTACATCTTTGACTATGA
TTACTACCGGGACGACTTCTACGACAGGCTCTTCGACTACCGGGGCCGTCTGTCGCCCGTGCCAGTGCCC
AGGGCGGTCCCTGTGAAGCGACCCCGGGTCACAGTCCCTTTGGTCCGGCGTGTCAAAACTAACGTACCTG
TCAAGCTCTTTGCCCGCTCCACAGCTGTCACCACCAGCTCAGCCAAGATCAAGTTAAAGAGCAGTGAGCT
GCAGGCCATCAAGACGGAGCTGACACAGATCAAGTCCAATATCGATGCCCTGCTGAGCCGCTTGGAGCAG
ATCGCTGCGGAGCAAAAGGCCAATCCAGATGGCAAGAAGAAGGGTGATGGAGGTGGCGCCAGCGGCGGCG
GCGGCGGTGGTGGTGGCAGCGGTGGCGGTGGCAGTGGTGGTGGCGGTGGCGGTGGCAGCAGCCGGCCACC
AGCCCCCCAAGAGAACACAACTTCTGAGGCAGGCCTGCCCCAGGGGGAAGCACGGACCCGAGACGACGGC
GATGAGGAAGGGCTCCTGACACACAGCGAGGAAGAGCTGGAACACAGCCAGGACACAGACGCGGATGATG
GGGCCTTGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210723 representing NM_016732
Red=Cloning site Green=Tags(s)

MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARA
AVLGENGRVLAGQTLDINMAGEPKPDRPKGLKRAASAIYSGYIFDYDYYRDDFYDRLFDYRGRLSPVPVP
RAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIKTELTQIKSNIDALLSRLEQ
IAAEQKANPDGKKKGDGGGASGGGGGGGGSGGGGSGGGGGGGSSRPPAPQENTTSEAGLPQGEARTRDDG
DEEGLLTHSEEELEHSQDTDADDGALQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_016732
ORF Size 921 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_016732.1, NM_016732.2, NP_057951
RefSeq Size 1589
RefSeq ORF 921
Locus ID 22913
Cytogenetics 20q11.22
Domains rrm
MW 32.3 kDa
Gene Summary This gene encodes a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) gene family. This protein may play a role in pre-mRNA splicing and in embryonic development. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations