RALY (NM_016732) Human Tagged ORF Clone

CAT#: RC210723

Reviews ()
Write a review

RALY (Myc-DDK-tagged)-Human RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) (RALY), transcript variant 1



Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product images

Other products for "RALY"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RALY
Synonyms HNRPCL2; P542
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210723 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTTGAAGCTTCAGGCAAGCAATGTAACCAACAAGAATGACCCCAAGTCCATCAACTCTCGAGTCT
TCATTGGAAACCTCAACACAGCTCTGGTGAAGAAATCAGATGTGGAGACCATCTTCTCTAAGTATGGCCG
TGTGGCCGGCTGTTCTGTGCACAAGGGCTATGCCTTTGTTCAGTACTCCAATGAGCGCCATGCCCGGGCA
GCTGTGCTGGGAGAGAATGGGCGGGTGCTGGCCGGGCAGACCCTGGACATCAACATGGCTGGAGAGCCTA
AGCCTGACAGACCCAAGGGGCTAAAGAGAGCAGCATCTGCCATATACAGTGGCTACATCTTTGACTATGA
TTACTACCGGGACGACTTCTACGACAGGCTCTTCGACTACCGGGGCCGTCTGTCGCCCGTGCCAGTGCCC
AGGGCGGTCCCTGTGAAGCGACCCCGGGTCACAGTCCCTTTGGTCCGGCGTGTCAAAACTAACGTACCTG
TCAAGCTCTTTGCCCGCTCCACAGCTGTCACCACCAGCTCAGCCAAGATCAAGTTAAAGAGCAGTGAGCT
GCAGGCCATCAAGACGGAGCTGACACAGATCAAGTCCAATATCGATGCCCTGCTGAGCCGCTTGGAGCAG
ATCGCTGCGGAGCAAAAGGCCAATCCAGATGGCAAGAAGAAGGGTGATGGAGGTGGCGCCAGCGGCGGCG
GCGGCGGTGGTGGTGGCAGCGGTGGCGGTGGCAGTGGTGGTGGCGGTGGCGGTGGCAGCAGCCGGCCACC
AGCCCCCCAAGAGAACACAACTTCTGAGGCAGGCCTGCCCCAGGGGGAAGCACGGACCCGAGACGACGGC
GATGAGGAAGGGCTCCTGACACACAGCGAGGAAGAGCTGGAACACAGCCAGGACACAGACGCGGATGATG
GGGCCTTGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210723 protein sequence
Red=Cloning site Green=Tags(s)

MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARA
AVLGENGRVLAGQTLDINMAGEPKPDRPKGLKRAASAIYSGYIFDYDYYRDDFYDRLFDYRGRLSPVPVP
RAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIKTELTQIKSNIDALLSRLEQ
IAAEQKANPDGKKKGDGGGASGGGGGGGGSGGGGSGGGGGGGSSRPPAPQENTTSEAGLPQGEARTRDDG
DEEGLLTHSEEELEHSQDTDADDGALQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016732
ORF Size 921 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016732.3
RefSeq Size 4790 bp
RefSeq ORF 921 bp
Locus ID 22913
UniProt ID Q9UKM9
Cytogenetics 20q11.22
Domains RRM
MW 32.6 kDa
Gene Summary This gene encodes a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) gene family. This protein may play a role in pre-mRNA splicing and in embryonic development. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.