BCL3 (NM_005178) Human Tagged ORF Clone

CAT#: RC209116

BCL3 (Myc-DDK-tagged)-Human B-cell CLL/lymphoma 3 (BCL3)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name BCL3 (NM_005178) Human Tagged ORF Clone
Symbol BCL3
Synonyms BCL4; D19S37
Vector pCMV6-Entry
Sequence Data
>RC209116 representing NM_005178
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGAGGGGCCCGTGGACCTGCGCACCCGGCCCAAGGCCGCCGGACTCCCGGGCGCCGCGCTGCCGC
TCCGCAAGCGCCCGCTGCGCGCGCCCTCCCCGGAGCCCGCCGCTCCCCGCGGCGCTGCGGGCCTTGTCGT
CCCCCTGGACCCTCTGCGCGGCGGCTGCGACCTGCCGGCGGTCCCCGGGCCCCCCCACGGCCTGGCCCGG
CCGGAGGCGCTTTACTACCCCGGAGCCTTACTGCCTTTGTACCCCACTCGGGCCATGGGCTCCCCGTTTC
CTCTGGTGAACCTGCCTACACCCCTATACCCCATGATGTGCCCCATGGAACACCCCCTTTCTGCTGACAT
CGCCATGGCCACCCGTGCAGATGAGGACGGAGACACGCCTCTCCATATTGCTGTGGTGCAGGGTAACCTG
CCAGCTGTGCACCGGCTGGTCAACCTCTTCCAGCAGGGGGGCCGGGAGCTCGACATCTACAACAACCTAC
GGCAGACACCGCTCCACCTGGCTGTGATCACCACATTACCGTCTGTGGTCCGGCTCCTGGTGACAGCTGG
TGCCAGCCCCATGGCGCTGGACCGCCATGGCCAGACGGCCGCTCACCTGGCGTGCGAGCACCGCAGCCCG
ACCTGCCTGCGAGCCCTGCTGGACAGCGCAGCTCCGGGCACGTTGGACCTGGAGGCCCGCAATTATGACG
GGCTCACCGCCCTGCACGTGGCAGTGAACACCGAGTGCCAAGAAACCGTGCAGCTCTTGCTAGAGCGCGG
TGCCGACATCGACGCAGTGGACATTAAGAGCGGCCGCTCCCCGCTCATCCACGCCGTGGAAAACAACAGC
CTTAGCATGGTGCAGCTGCTGCTGCAGCACGGCGCCAACGTGAACGCGCAAATGTACTCCGGCAGCTCCG
CCCTGCACTCAGCGTCCGGCCGCGGGCTCCTCCCGCTGGTGCGCACGCTGGTCCGCAGCGGCGCTGACAG
CAGCCTCAAGAACTGCCACAACGACACGCCGCTCATGGTGGCGCGCAGCCGCAGGGTCATCGACATCCTG
AGGGGGAAGGCCACCCGGCCTGCTTCCACCTCCCAGCCAGACCCCTCCCCTGACCGGAGCGCCAACACCT
CCCCCGAGAGCAGCAGCCGCCTCAGCTCCAATGGTCTTCTCTCCGCATCACCATCCTCCTCACCCTCCCA
GTCTCCCCCCAGGGACCCCCCTGGATTCCCCATGGCTCCTCCCAATTTCTTCCTTCCTTCCCCATCTCCA
CCCGCCTTCCTGCCCTTTGCTGGGGTCCTCCGAGGCCCTGGCCGGCCGGTGCCCCCCTCCCCAGCTCCAG
GAGGCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209116 representing NM_005178
Red=Cloning site Green=Tags(s)

MDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPLRGGCDLPAVPGPPHGLAR
PEALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHPLSADIAMATRADEDGDTPLHIAVVQGNL
PAVHRLVNLFQQGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSP
TCLRALLDSAAPGTLDLEARNYDGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNS
LSMVQLLLQHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDIL
RGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPSSSPSQSPPRDPPGFPMAPPNFFLPSPSP
PAFLPFAGVLRGPGRPVPPSPAPGGS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005178
ORF Size 1338 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005178.1, NM_005178.2, NM_005178.3, NP_005169
RefSeq Size 1864
RefSeq ORF 1365
Locus ID 602
Cytogenetics 19q13.32
Domains ANK
Protein Families Transcription Factors, Druggable Genome
MW 47.4 kDa
Gene Summary This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those found in I kappa B proteins. This protein functions as a transcriptional co-activator that activates through its association with NF-kappa B homodimers. The expression of this gene can be induced by NF-kappa B, which forms a part of the autoregulatory loop that controls the nuclear residence of p50 NF-kappa B. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)