UBL4A (NM_014235) Human Tagged ORF Clone

CAT#: RC208121

UBL4A (Myc-DDK-tagged)-Human ubiquitin-like 4A (UBL4A)

Product Images

Circular map for RC208121

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY UBL4A (Cat# RC208121, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-UBL4A(Cat# TA502416). Positive lysates LY415426 (100ug) and LC415426 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY415426) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC208121 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: UBL4A
• Synonyms: DX254E; DXS254E; G6PD; GDX; GET5; MDY2; TMA24; UBL4
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC208121 representing NM_014235
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCAGCTGACGGTGAAGGCGCTGCAGGGCCGCGAGTGCAGCCTGCAGGTGCCAGAGGACGAGCTGGTGT
  CCACGCTGAAGCAGCTGGTCTCCGAGAAGCTGAACGTCCCAGTGCGCCAGCAGCGGCTGCTGTTCAAGGG
  CAAGGCCCTGGCAGATGGGAAACGACTCTCGGATTATAGCATCGGGCCCAACTCCAAGCTCAACCTAGTG
  GTCAAACCCCTGGAGAAGGTGCTACTAGAAGAAGGCGAGGCCCAGAGGCTGGCCGACTCCCCACCCCCGC
  AGGTCTGGCAGCTGATCTCCAAAGTCTTGGCCCGCCACTTCAGTGCGGCAGATGCCAGCAGGGTCCTGGA
  ACAGCTACAGAGGGATTACGAGAGGTCCCTGAGTCGCCTGACGCTGGACGACATCGAACGGTTGGCCAGC
  CGCTTCCTGCACCCTGAAGTGACTGAGACAATGGAGAAGGGCTTCTCCAAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC208121 representing NM_014235
  Red=Cloning site Green=Tags(s)
  
  MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLV
  VKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLAS
  RFLHPEVTETMEKGFSK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_014235
• ORF Size: 471 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_014235.5
• RefSeq Size: 2322 bp
• RefSeq ORF: 474 bp
• Locus ID: 8266
• UniProt ID: P11441
• Cytogenetics: Xq28
• Domains: UBQ
• Protein Families: Druggable Genome
• MW: 17.6 kDa
• Gene Summary: As part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates to their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation (PubMed:20676083, PubMed:21636303, PubMed:21743475, PubMed:28104892). The BAG6/BAT3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Recruited to ribosomes, it interacts with the transmembrane region of newly synthesized tail-anchored proteins and together with SGTA and ASNA1 mediates their delivery to the endoplasmic reticulum (PubMed:20676083, PubMed:28104892, PubMed:25535373). Client proteins that cannot be properly delivered to the endoplasmic reticulum are ubiquitinated and sorted to the proteasome (PubMed:28104892). Similarly, the BAG6/BAT3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum (PubMed:21743475). The BAG6/BAT3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome (PubMed:21636303).[UniProtKB/Swiss-Prot Function]