TLR2 (NM_003264) Human Tagged ORF Clone

CAT#: RC207597

Reviews ()
Write a review

TLR2 (Myc-DDK-tagged)-Human toll-like receptor 2 (TLR2)



  "NM_003264" in other vectors (6)

Reconstitution Protocol

USD 718.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "TLR2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TLR2
Synonyms CD282; TIL4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207597 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCACATACTTTGTGGATGGTGTGGGTCTTGGGGGTCATCATCAGCCTCTCCAAGGAAGAATCCTCCA
ATCAGGCTTCTCTGTCTTGTGACCGCAATGGTATCTGCAAGGGCAGCTCAGGATCTTTAAACTCCATTCC
CTCAGGGCTCACAGAAGCTGTAAAAAGCCTTGACCTGTCCAACAACAGGATCACCTACATTAGCAACAGT
GACCTACAGAGGTGTGTGAACCTCCAGGCTCTGGTGCTGACATCCAATGGAATTAACACAATAGAGGAAG
ATTCTTTTTCTTCCCTGGGCAGTCTTGAACATTTAGACTTATCCTATAATTACTTATCTAATTTATCGTC
TTCCTGGTTCAAGCCCCTTTCTTCTTTAACATTCTTAAACTTACTGGGAAATCCTTACAAAACCCTAGGG
GAAACATCTCTTTTTTCTCATCTCACAAAATTGCAAATCCTGAGAGTGGGAAATATGGACACCTTCACTA
AGATTCAAAGAAAAGATTTTGCTGGACTTACCTTCCTTGAGGAACTTGAGATTGATGCTTCAGATCTACA
GAGCTATGAGCCAAAAAGTTTGAAGTCAATTCAGAACGTAAGTCATCTGATCCTTCATATGAAGCAGCAT
ATTTTACTGCTGGAGATTTTTGTAGATGTTACAAGTTCCGTGGAATGTTTGGAACTGCGAGATACTGATT
TGGACACTTTCCATTTTTCAGAACTATCCACTGGTGAAACAAATTCATTGATTAAAAAGTTTACATTTAG
AAATGTGAAAATCACCGATGAAAGTTTGTTTCAGGTTATGAAACTTTTGAATCAGATTTCTGGATTGTTA
GAATTAGAGTTTGATGACTGTACCCTTAATGGAGTTGGTAATTTTAGAGCATCTGATAATGACAGAGTTA
TAGATCCAGGTAAAGTGGAAACGTTAACAATCCGGAGGCTGCATATTCCAAGGTTTTACTTATTTTATGA
TCTGAGCACTTTATATTCACTTACAGAAAGAGTTAAAAGAATCACAGTAGAAAACAGTAAAGTTTTTCTG
GTTCCTTGTTTACTTTCACAACATTTAAAATCATTAGAATACTTGGATCTCAGTGAAAATTTGATGGTTG
AAGAATACTTGAAAAATTCAGCCTGTGAGGATGCCTGGCCCTCTCTACAAACTTTAATTTTAAGGCAAAA
TCATTTGGCATCATTGGAAAAAACCGGAGAGACTTTGCTCACTCTGAAAAACTTGACTAACATTGATATC
AGTAAGAATAGTTTTCATTCTATGCCTGAAACTTGTCAGTGGCCAGAAAAGATGAAATATTTGAACTTAT
CCAGCACACGAATACACAGTGTAACAGGCTGCATTCCCAAGACACTGGAAATTTTAGATGTTAGCAACAA
CAATCTCAATTTATTTTCTTTGAATTTGCCGCAACTCAAAGAACTTTATATTTCCAGAAATAAGTTGATG
ACTCTACCAGATGCCTCCCTCTTACCCATGTTACTAGTATTGAAAATCAGTAGGAATGCAATAACTACGT
TTTCTAAGGAGCAACTTGACTCATTTCACACACTGAAGACTTTGGAAGCTGGTGGCAATAACTTCATTTG
CTCCTGTGAATTCCTCTCCTTCACTCAGGAGCAGCAAGCACTGGCCAAAGTCTTGATTGATTGGCCAGCA
AATTACCTGTGTGACTCTCCATCCCATGTGCGTGGCCAGCAGGTTCAGGATGTCCGCCTCTCGGTGTCGG
AATGTCACAGGACAGCACTGGTGTCTGGCATGTGCTGTGCTCTGTTCCTGCTGATCCTGCTCACGGGGGT
CCTGTGCCACCGTTTCCATGGCCTGTGGTATATGAAAATGATGTGGGCCTGGCTCCAGGCCAAAAGGAAG
CCCAGGAAAGCTCCCAGCAGGAACATCTGCTATGATGCATTTGTTTCTTACAGTGAGCGGGATGCCTACT
GGGTGGAGAACCTTATGGTCCAGGAGCTGGAGAACTTCAATCCCCCCTTCAAGTTGTGTCTTCATAAGCG
GGACTTCATTCCTGGCAAGTGGATCATTGACAATATCATTGACTCCATTGAAAAGAGCCACAAAACTGTC
TTTGTGCTTTCTGAAAACTTTGTGAAGAGTGAGTGGTGCAAGTATGAACTGGACTTCTCCCATTTCCGTC
TTTTTGATGAGAACAATGATGCTGCCATTCTCATTCTTCTGGAGCCCATTGAGAAAAAAGCCATTCCCCA
GCGCTTCTGCAAGCTGCGGAAGATAATGAACACCAAGACCTACCTGGAGTGGCCCATGGACGAGGCTCAG
CGGGAAGGATTTTGGGTAAATCTGAGAGCTGCGATAAAGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207597 protein sequence
Red=Cloning site Green=Tags(s)

MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYISNS
DLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLG
ETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQH
ILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLL
ELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFL
VPCLLSQHLKSLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDI
SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLM
TLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPA
NYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAWLQAKRK
PRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTV
FVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQ
REGFWVNLRAAIKS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003264
ORF Size 2352 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003264.5
RefSeq Size 3417 bp
RefSeq ORF 2355 bp
Locus ID 7097
UniProt ID O60603
Cytogenetics 4q31.3
Domains TIR, LRRCT, LRR, LRR_TYP, LRR_BAC, LRR_PS
Protein Families Druggable Genome, Transmembrane
Protein Pathways Toll-like receptor signaling pathway
MW 89.8 kDa
Gene Summary The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. This protein is a cell-surface protein that can form heterodimers with other TLR family members to recognize conserved molecules derived from microorganisms known as pathogen-associated molecular patterns (PAMPs). Activation of TLRs by PAMPs leads to an up-regulation of signaling pathways to modulate the host's inflammatory response. This gene is also thought to promote apoptosis in response to bacterial lipoproteins. This gene has been implicated in the pathogenesis of several autoimmune diseases. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.