BID (NM_001196) Human Tagged ORF Clone

CAT#: RC207261

Reviews ()
Write a review

BID (Myc-DDK-tagged)-Human BH3 interacting domain death agonist (BID), transcript variant 2


  "NM_001196" in other vectors (5)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name BID (NM_001196) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BID
Synonyms FP497
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC207261 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGCAGCGGTGCTGGGGTCATGATGGCTCGGTGGGCAGCGAGGGGCCGGGCCGGCTGGAGGAGCACAG
TGCGGATTCTGTCGCCACTGGGACACTGTGAACCAGGAGTGAGTCGGAGCTGCCGCGCTGCCCAGGCCAT
GGACTGTGAGGTCAACAACGGTTCCAGCCTCAGGGATGAGTGCATCACAAACCTACTGGTGTTTGGCTTC
CTCCAAAGCTGTTCTGACAACAGCTTCCGCAGAGAGCTGGACGCACTGGGCCACGAGCTGCCAGTGCTGG
CTCCCCAGTGGGAGGGCTACGATGAGCTGCAGACTGATGGCAACCGCAGCAGCCACTCCCGCTTGGGAAG
AATAGAGGCAGATTCTGAAAGTCAAGAAGACATCATCCGGAATATTGCCAGGCACCTCGCCCAGGTCGGG
GACAGCATGGACCGTAGCATCCCTCCGGGCCTGGTGAACGGCCTGGCCCTGCAGCTCAGGAACACCAGCC
GGTCGGAGGAGGACCGGAACAGGGACCTGGCCACTGCCCTGGAGCAGCTGCTGCAGGCCTACCCTAGAGA
CATGGAGAAGGAGAAGACCATGCTGGTGCTGGCCCTGCTGCTGGCCAAGAAGGTGGCCAGTCAAACGCCG
TCCTTGCTCCGTGATGTCTTTCACACAACAGTGAACTTTATTAACCAGAACCTACGCACCTACGTGAGGA
GCTTAGCCAGAAATGGGATGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207261 protein sequence
Red=Cloning site Green=Tags(s)

MCSGAGVMMARWAARGRAGWRSTVRILSPLGHCEPGVSRSCRAAQAMDCEVNNGSSLRDECITNLLVFGF
LQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVG
DSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASQTP
SLLRDVFHTTVNFINQNLRTYVRSLARNGMD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001196
ORF Size 726 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq Size 2217
RefSeq ORF 588
Locus ID 637
Cytogenetics 22q11.21
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Natural killer cell mediated cytotoxicity, p53 signaling pathway, Pathways in cancer, Viral myocarditis
MW 26.8 kDa
Gene Summary This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


BID mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools