Lipin 1 (LPIN1) (NM_145693) Human Tagged ORF Clone

CAT#: RC207138

Reviews ()
Write a review

LPIN1 (Myc-DDK-tagged)-Human lipin 1 (LPIN1)



  "NM_145693" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol LPIN1
Synonyms PAP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207138 representing NM_145693
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATTACGTGGGGCAGTTAGCCGGCCAGGTGTTTGTCACCGTGAAGGAGCTCTACAAGGGGCTGAATC
CCGCCACACTCTCAGGGTGCATTGACATCATTGTCATCCGCCAGCCCAATGGAAACCTCCAATGCTCCCC
TTTCCACGTCCGCTTTGGGAAGATGGGGGTCCTGCGCTCCCGAGAGAAAGTGGTTGACATAGAAATCAAT
GGGGAATCTGTGGATTTGCATATGAAATTGGGAGATAATGGAGAAGCATTTTTTGTTCAAGAAACAGATA
ATGATCAGGAAGTTATCCCTATGCACCTGGCCACCTCCCCCATCCTGTCAGAAGGAGCTTCGAGAATGGA
ATGCCAGCTGAAAAGGGGCTCTGTGGACAGGATGAGAGGCCTGGACCCCAGCACGCCAGCCCAAGTGATC
GCTCCCAGCGAGACGCCGTCAAGCAGCTCTGTAGTAAAGAAGAGAAGAAAAAGGAGGAGAAAGTCACAGC
TGGACAGCCTGAAGAGAGATGACAACATGAACACATCTGAGGATGAGGACATGTTCCCCATCGAGATGAG
CTCGGATGAGGCCATGGAGCTGCTGGAGAGCAGCAGAACTCTTCCTAATGATATACCTCCATTCCAAGAT
GATATTCCTGAGGAAAACCTCTCCCTGGCTGTGATTTACCCTCAGTCAGCCTCATACCCTAATTCGGATA
GAGAGTGGTCACCCACTCCCAGTCCTTCCGGTTCCCGACCTTCAACACCTAAAAGTGATTCAGAATTGGT
CAGCAAGTCCACGGAAAGGACAGGGCAGAAGAACCCAGAAATGCTTTGGCTGTGGGGAGAGCTGCCGCAG
GCTGCTAAGTCTTCTTCTCCACACAAGATGAAAGAGTCCAGCCCATTGAGCAGTAGAAAAATTTGTGATA
AAAGTCACTTTCAGGCCATTCACAGCGAATCTTCAGACACTTTTAGTGACCAATCGCCAACTCTGGTCGG
TGGGGCACTTTTGGACCAGAACAAGCCTCAGACAGAAATGCAGTTTGTGAATGAAGAAGACCTGGAGACC
TTAGGAGCAGCAGCGCCACTCTTGCCCATGATCGAGGAGCTCAAACCCCCCTCTGCCAGTGTAGTCCAGA
CAGCAAACAAGACGGATTCTCCTTCCAGGAAAAGAGATAAACGAAGCCGACATCTTGGTGCTGACGGCGT
CTACTTGGATGACCTCACAGACATGGATCCTGAAGTGGCGGCCCTGTATTTTCCCAAAAACGGAGATCCT
TCCGGACTCGCAAAACATGCAAGCGACAACGGAGCCCGGTCAGCCAACCAGTCCCCGCAGTCGGTGGGCA
GCTCGGGCGTGGACAGTGGCGTGGAGAGCACCTCGGACGGGCTGAGGGACCTCCCTTCCATCGCCATCTC
CCTCTGCGGGGGCCTCAGCGACCACCGGGAGATCACGAAAGATGCATTCCTGGAGCAAGCTGTGTCATAT
CAACAGTTTGTGGACAACCCCGCTATTATCGATGACCCCAATCTCGTGGTAAAGATTGGGAGTAAATATT
ATAACTGGACAACAGCAGCACCCCTCCTCCTGGCAATGCAGGCCTTCCAGAAACCTTTGCCAAAGGCCAC
TGTGGAATCTATCATGAGGGATAAAATGCCCAAAAAGGGAGGAAGATGGTGGTTTTCATGGAGGGGAAGA
AACACCACAATCAAGGAGGAAAGTAAGCCAGAGCAGTGCTTGGCTGGCAAGGCCCATAGCACCGGAGAGC
AACCGCCGCAGCTCAGCTTGGCCACCAGGGTAAAGCATGAATCATCCTCCAGTGATGAGGAGCGCGCAGC
TGCCAAGCCATCAAACGCAGGCCACCTCCCTCTTCTGCCTAATGTCAGCTACAAGAAGACTCTCCGGCTG
ACTTCCGAGCAGCTTAAAAGCTTGAAGTTGAAGAATGGCCCCAACGACGTGGTTTTCAGTGTCACCACGC
AGTACCAAGGCACGTGCCGCTGTGAGGGCACCATCTATCTGTGGAACTGGGATGATAAAGTCATCATTTC
TGATATTGATGGGACAATTACCAGATCAGATACTCTTGGCCACATTTTGCCCACCCTTGGGAAGGATTGG
ACCCATCAGGGCATCGCTAAGCTGTACCATAAAGTGAGCCAGAATGGATATAAATTTCTCTACTGTTCTG
CCCGTGCCATCGGGATGGCGGACATGACGCGGGGCTACCTGCACTGGGTCAACGAGAGGGGCACGGTGCT
GCCCCAGGGGCCCCTGCTGCTGAGTCCCAGCAGCCTCTTCTCTGCCCTGCACAGAGAAGTGATTGAAAAG
AAGCCAGAAAAGTTTAAAGTCCAGTGTTTGACAGACATCAAAAACCTGTTTTTCCCCAACACAGAACCCT
TTTATGCTGCTTTTGGAAACCGACCAGCTGATGTGTATTCATACAAGCAAGTAGGAGTGTCTTTGAATAG
AATATTTACCGTCAACCCTAAAGGAGAGCTGGTACAGGAACATGCAAAGACCAACATCTCTTCGTATGTG
AGACTCTGTGAAGTAGTCGACCACGTTTTCCCGTTGCTGAAAAGAAGCCATTCTTCAGACTTTCCCTGTT
CGGATACCTTCAGTAACTTCACCTTTTGGAGAGAGCCACTGCCACCTTTTGAAAACCAGGACATTCATTC
TGCCTCAGCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207138 representing NM_145693
Red=Cloning site Green=Tags(s)

MNYVGQLAGQVFVTVKELYKGLNPATLSGCIDIIVIRQPNGNLQCSPFHVRFGKMGVLRSREKVVDIEIN
GESVDLHMKLGDNGEAFFVQETDNDQEVIPMHLATSPILSEGASRMECQLKRGSVDRMRGLDPSTPAQVI
APSETPSSSSVVKKRRKRRRKSQLDSLKRDDNMNTSEDEDMFPIEMSSDEAMELLESSRTLPNDIPPFQD
DIPEENLSLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQKNPEMLWLWGELPQ
AAKSSSPHKMKESSPLSSRKICDKSHFQAIHSESSDTFSDQSPTLVGGALLDQNKPQTEMQFVNEEDLET
LGAAAPLLPMIEELKPPSASVVQTANKTDSPSRKRDKRSRHLGADGVYLDDLTDMDPEVAALYFPKNGDP
SGLAKHASDNGARSANQSPQSVGSSGVDSGVESTSDGLRDLPSIAISLCGGLSDHREITKDAFLEQAVSY
QQFVDNPAIIDDPNLVVKIGSKYYNWTTAAPLLLAMQAFQKPLPKATVESIMRDKMPKKGGRWWFSWRGR
NTTIKEESKPEQCLAGKAHSTGEQPPQLSLATRVKHESSSSDEERAAAKPSNAGHLPLLPNVSYKKTLRL
TSEQLKSLKLKNGPNDVVFSVTTQYQGTCRCEGTIYLWNWDDKVIISDIDGTITRSDTLGHILPTLGKDW
THQGIAKLYHKVSQNGYKFLYCSARAIGMADMTRGYLHWVNERGTVLPQGPLLLSPSSLFSALHREVIEK
KPEKFKVQCLTDIKNLFFPNTEPFYAAFGNRPADVYSYKQVGVSLNRIFTVNPKGELVQEHAKTNISSYV
RLCEVVDHVFPLLKRSHSSDFPCSDTFSNFTFWREPLPPFENQDIHSASA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_145693
ORF Size 2670 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_145693.4
RefSeq Size 5363 bp
RefSeq ORF 2673 bp
Locus ID 23175
UniProt ID Q14693
Cytogenetics 2p25.1
Domains lipin_N
MW 98.5 kDa
Gene Summary This gene encodes a magnesium-ion-dependent phosphatidic acid phosphohydrolase enzyme that catalyzes the penultimate step in triglyceride synthesis including the dephosphorylation of phosphatidic acid to yield diacylglycerol. Expression of this gene is required for adipocyte differentiation and it also functions as a nuclear transcriptional coactivator with some peroxisome proliferator-activated receptors to modulate expression of other genes involved in lipid metabolism. Mutations in this gene are associated with metabolic syndrome, type 2 diabetes, acute recurrent rhabdomyolysis, and autosomal recessive acute recurrent myoglobinuria (ARARM). This gene is also a candidate for several human lipodystrophy syndromes. [provided by RefSeq, Mar 2017]

Other Versions

Other products for "LPIN1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


LPIN1 mouse monoclonal antibody, clone OTI8F10 (formerly 8F10)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.