CDRL2(CDR2L) (NM_014603) Human Tagged ORF Clone

CAT#: RC206909

CDR2L (Myc-DDK-tagged)-Human cerebellar degeneration-related protein 2-like (CDR2L)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CDRL2(CDR2L) (NM_014603) Human Tagged ORF Clone
Symbol CDR2L
Synonyms HUMPPA; HUMPPA
Vector pCMV6-Entry
Sequence Data
>RC206909 representing NM_014603
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGAGAGCCGCCGGGATGGAGGACTTCTCCGCGGAGGAAGAGGAGTCCTGGTACGACCAGCAGGACC
TGGAGCAGGACTTGCACCTAGCTGCGGAGCTGGGGAAGACTCTGCTGGAGAGGAACAAGGAGCTGGAGGG
GTCCCTGCAGCAGATGTACTCCACCAATGAGGAACAGGTGCAGGAGATCGAGTACCTAACCAAGCAGCTG
GACACGCTGCGGCACGTGAACGAGCAGCACGCCAAAGTCTATGAGCAGCTGGACCTGACAGCCCGGGACC
TGGAGCTGACCAACCACAGGCTGGTGCTGGAGAGTAAGGCTGCCCAGCAGAAGATCCATGGGCTGACGGA
GACCATTGAGCGCCTCCAGGCTCAGGTGGAGGAGCTGCAGGCCCAGGTGGAGCAACTGAGAGGCCTGGAA
CAGCTGCGAGTGCTCCGGGAGAAGCGGGAACGCAGGCGTACCATCCACACCTTCCCCTGCCTCAAGGAGC
TGTGCACCAGCCCCCGGTGCAAGGATGCTTTCCGCCTACACAGTTCCTCCCTGGAGCTGGGCCCGCGGCC
CCTGGAGCAGGAGAACGAGCGGCTGCAGACCCTGGTGGGGGCGCTGCGCTCCCAGGTGAGCCAGGAGCGG
CAGCGCAAGGAGCGGGCGGAGCGCGAGTACACCGCGGTGCTGCAGGAGTACTCGGAGCTGGAGCGCCAGC
TGTGCGAGATGGAGGCCTGTCGCCTGCGTGTGCAGGAGCTGGAGGCCGAGCTGCTGGAGCTGCAGCAGAT
GAAGCAGGCCAAGACCTACCTACTGGGTCCGGACGACCACCTGGCCGAGGCCCTGCTCGCACCCCTCACG
CAGGCCCCTGAGGCCGACGATCCCCAGCCCGGCCGCGGGGACGACTTGGGCGCCCAGGACGGGGTCTCCT
CACCGGCAGCCTCTCCAGGCCACGTGGTGCGCAAGAGCTGCAGCGACACTGCGCTCAACGCCATCGTGGC
CAAAGACCCAGCCAGCCGGCACGCGGGCAACCTCACACTGCACGCCAACAGCGTGCGCAAGCGGGGCATG
TCCATCCTGCGGGAGGTGGACGAGCAGTACCACGCGCTGCTGGAGAAGTACGAGGAGCTGCTGAGCAAGT
GCCGGCAGCACGGGGCCGGAGTGCGGCACGCCGGCGTGCAGACCTCGCGCCCCATCTCCCGGGACAGCTC
GTGGAGGGACCTGCGCGGGGGTGAGGAGGGCCAGGGTGAGGTCAAGGCAGGAGAGAAGAGCCTGAGCCAG
CACGTGGAGGCCGTGGACAAGCGGCTGGAACAGAGCCAGCCCGAGTACAAGGCGCTCTTCAAAGAGATCT
TCTCCAGGATCCAGAAGACCAAGGCTGACATCAACGCCACCAAAGTCAAGACGCACAGCAGCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206909 representing NM_014603
Red=Cloning site Green=Tags(s)

MRRAAGMEDFSAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQQMYSTNEEQVQEIEYLTKQL
DTLRHVNEQHAKVYEQLDLTARDLELTNHRLVLESKAAQQKIHGLTETIERLQAQVEELQAQVEQLRGLE
QLRVLREKRERRRTIHTFPCLKELCTSPRCKDAFRLHSSSLELGPRPLEQENERLQTLVGALRSQVSQER
QRKERAEREYTAVLQEYSELERQLCEMEACRLRVQELEAELLELQQMKQAKTYLLGPDDHLAEALLAPLT
QAPEADDPQPGRGDDLGAQDGVSSPAASPGHVVRKSCSDTALNAIVAKDPASRHAGNLTLHANSVRKRGM
SILREVDEQYHALLEKYEELLSKCRQHGAGVRHAGVQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQ
HVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSSK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014603
ORF Size 1395 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014603.2, NP_055418
RefSeq Size 3546
RefSeq ORF 1398
Locus ID 30850
Cytogenetics 17q25.1
MW 52.8 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)