AXL (NM_021913) Human Tagged ORF Clone

CAT#: RC206431

Reviews ()
Write a review

AXL (Myc-DDK-tagged)-Human AXL receptor tyrosine kinase (AXL), transcript variant 1



  "NM_021913" in other vectors (8)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name AXL (NM_021913) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol AXL
Synonyms ARK; JTK11; Tyro7; UFO
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC206431 representing NM_021913
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTGGCGGTGCCCCAGGATGGGCAGGGTCCCGCTGGCCTGGTGCTTGGCGCTGTGCGGCTGGGCGT
GCATGGCCCCCAGGGGCACGCAGGCTGAAGAAAGTCCCTTCGTGGGCAACCCAGGGAATATCACAGGTGC
CCGGGGACTCACGGGCACCCTTCGGTGTCAGCTCCAGGTTCAGGGAGAGCCCCCCGAGGTACATTGGCTT
CGGGATGGACAGATCCTGGAGCTCGCGGACAGCACCCAGACCCAGGTGCCCCTGGGTGAGGATGAACAGG
ATGACTGGATAGTGGTCAGCCAGCTCAGAATCACCTCCCTGCAGCTTTCCGACACGGGACAGTACCAGTG
TTTGGTGTTTCTGGGACATCAGACCTTCGTGTCCCAGCCTGGCTATGTTGGGCTGGAGGGCTTGCCTTAC
TTCCTGGAGGAGCCCGAAGACAGGACTGTGGCCGCCAACACCCCCTTCAACCTGAGCTGCCAAGCTCAGG
GACCCCCAGAGCCCGTGGACCTACTCTGGCTCCAGGATGCTGTCCCCCTGGCCACGGCTCCAGGTCACGG
CCCCCAGCGCAGCCTGCATGTTCCAGGGCTGAACAAGACATCCTCTTTCTCCTGCGAAGCCCATAACGCC
AAGGGGGTCACCACATCCCGCACAGCCACCATCACAGTGCTCCCCCAGCAGCCCCGTAACCTCCACCTGG
TCTCCCGCCAACCCACGGAGCTGGAGGTGGCTTGGACTCCAGGCCTGAGCGGCATCTACCCCCTGACCCA
CTGCACCCTGCAGGCTGTGCTGTCAGACGATGGGATGGGCATCCAGGCGGGAGAACCAGACCCCCCAGAG
GAGCCCCTCACCTCGCAAGCATCCGTGCCCCCCCATCAGCTTCGGCTAGGCAGCCTCCATCCTCACACCC
CTTATCACATCCGCGTGGCATGCACCAGCAGCCAGGGCCCCTCATCCTGGACCCACTGGCTTCCTGTGGA
GACGCCGGAGGGAGTGCCCCTGGGCCCCCCTGAGAACATTAGTGCTACGCGGAATGGGAGCCAGGCCTTC
GTGCATTGGCAAGAGCCCCGGGCGCCCCTGCAGGGTACCCTGTTAGGGTACCGGCTGGCGTATCAAGGCC
AGGACACCCCAGAGGTGCTAATGGACATAGGGCTAAGGCAAGAGGTGACCCTGGAGCTGCAGGGGGACGG
GTCTGTGTCCAATCTGACAGTGTGTGTGGCAGCCTACACTGCTGCTGGGGATGGACCCTGGAGCCTCCCA
GTACCCCTGGAGGCCTGGCGCCCAGGGCAAGCACAGCCAGTCCACCAGCTGGTGAAGGAACCTTCAACTC
CTGCCTTCTCGTGGCCCTGGTGGTATGTACTGCTAGGAGCAGTCGTGGCCGCTGCCTGTGTCCTCATCTT
GGCTCTCTTCCTTGTCCACCGGCGAAAGAAGGAGACCCGTTATGGAGAAGTGTTTGAACCAACAGTGGAA
AGAGGTGAACTGGTAGTCAGGTACCGCGTGCGCAAGTCCTACAGTCGTCGGACCACTGAAGCTACCTTGA
ACAGCTTGGGCATCAGTGAAGAGCTGAAGGAGAAGCTGCGGGATGTGATGGTGGACCGGCACAAGGTGGC
CCTGGGGAAGACTCTGGGAGAGGGAGAGTTTGGAGCTGTGATGGAAGGCCAGCTCAACCAGGACGACTCC
ATCCTCAAGGTGGCTGTGAAGACGATGAAGATTGCCATCTGCACGAGGTCAGAGCTGGAGGATTTCCTGA
GTGAAGCGGTCTGCATGAAGGAATTTGACCATCCCAACGTCATGAGGCTCATCGGTGTCTGTTTCCAGGG
TTCTGAACGAGAGAGCTTCCCAGCACCTGTGGTCATCTTACCTTTCATGAAACATGGAGACCTACACAGC
TTCCTCCTCTATTCCCGGCTCGGGGACCAGCCAGTGTACCTGCCCACTCAGATGCTAGTGAAGTTCATGG
CAGACATCGCCAGTGGCATGGAGTATCTGAGTACCAAGAGATTCATACACCGGGACCTGGCGGCCAGGAA
CTGCATGCTGAATGAGAACATGTCCGTGTGTGTGGCGGACTTCGGGCTCTCCAAGAAGATCTACAATGGG
GACTACTACCGCCAGGGACGTATCGCCAAGATGCCAGTCAAGTGGATTGCCATTGAGAGTCTAGCTGACC
GTGTCTACACCAGCAAGAGCGATGTGTGGTCCTTCGGGGTGACAATGTGGGAGATTGCCACAAGAGGCCA
AACCCCATATCCGGGCGTGGAGAACAGCGAGATTTATGACTATCTGCGCCGGGGAAATCGCCTGAAGCAG
CCTGCGGACTGTCTGGATGGACTGTATGCCTTGATGTCGCGGTGCTGGGAGCTAAATCCCCAGGACCGGC
CAAGTTTTACAGAGCTGCGGGAAGATTTGGAGAACACACTGAAGGCCTTGCCTCCTGCCCAGGAGCCTGA
CGAAATCCTCTATGTCAACATGGATGAGGGTGGAGGTTATCCTGAACCCCCTGGAGCTGCAGGAGGAGCT
GACCCCCCAACCCAGCCAGACCCTAAGGATTCCTGTAGCTGCCTCACTGCGGCTGAGGTCCATCCTGCTG
GACGCTATGTCCTCTGCCCTTCCACAACCCCTAGCCCCGCTCAGCCTGCTGATAGGGGCTCCCCAGCAGC
CCCAGGGCAGGAGGATGGTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206431 representing NM_021913
Red=Cloning site Green=Tags(s)

MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWL
RDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPY
FLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRSLHVPGLNKTSSFSCEAHNA
KGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPE
EPLTSQASVPPHQLRLGSLHPHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAF
VHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLP
VPLEAWRPGQAQPVHQLVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVE
RGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDS
ILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKHGDLHS
FLLYSRLGDQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNG
DYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRRGNRLKQ
PADCLDGLYALMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGA
DPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021913
ORF Size 2682 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021913.1, NM_021913.2, NM_021913.3, NM_021913.4, NP_068713.2
RefSeq Size 5014 bp
RefSeq ORF 2685 bp
Locus ID 558
Cytogenetics 19q13.2
Protein Families Druggable Genome, Protein Kinase, Transmembrane
MW 98.2 kDa
Gene Summary The protein encoded by this gene is a member of the Tyro3-Axl-Mer (TAM) receptor tyrosine kinase subfamily. The encoded protein possesses an extracellular domain which is composed of two immunoglobulin-like motifs at the N-terminal, followed by two fibronectin type-III motifs. It transduces signals from the extracellular matrix into the cytoplasm by binding to the vitamin K-dependent protein growth arrest-specific 6 (Gas6). This gene may be involved in several cellular functions including growth, migration, aggregation and anti-inflammation in multiple cell types. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]

Citations (4)

Other Versions

Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit anti AXL/UFO (Phospho) Polyclonal Antibody
    • 100 ug

USD 355.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools