CUG BP1(CELF1) (NM_006560) Human Tagged ORF Clone

CAT#: RC206275

CELF1 (Myc-DDK-tagged)-Human CUGBP, Elav-like family member 1 (CELF1), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CUG BP1(CELF1) (NM_006560) Human Tagged ORF Clone
Symbol CELF1
Synonyms BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC206275 representing NM_006560
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACGGCACCCTGGACCACCCAGACCAACCAGATCTTGATGCTATCAAGATGTTTGTGGGCCAGGTTC
CAAGGACCTGGTCTGAAAAGGACTTGCGGGAACTCTTCGAACAGTATGGTGCTGTGTATGAAATCAACGT
CCTAAGGGATAGGAGCCAAAACCCGCCTCAGAGCAAAGGGTGCTGTTTTGTTACATTTTACACCCGTAAA
GCTGCATTAGAAGCTCAGAATGCTCTTCACAACATGAAAGTCCTCCCAGGGATGCATCACCCTATACAGA
TGAAACCTGCTGACAGTGAGAAGAACAATGCAGTGGAAGACAGGAAGCTGTTTATTGGTATGATTTCCAA
GAAGTGCACTGAAAATGACATCCGAGTCATGTTCTCTTCGTTTGGACAGATTGAAGAATGCCGGATATTG
CGGGGACCTGATGGCCTGAGCCGAGGTTGTGCATTTGTGACTTTTACAACAAGAGCCATGGCACAGACGG
CTATCAAGGCAATGCACCAAGCACAGACCATGGAGGGTTGCTCATCACCCATGGTGGTAAAATTTGCTGA
TACACAGAAGGACAAAGAACAGAAGAGAATGGCCCAGCAGCTCCAGCAGCAGATGCAGCAAATCAGCGCA
GCATCTGTGTGGGGAAACCTTGCTGGTCTAAATACTCTTGGACCCCAGTATTTAGCACTCCTTCAGCAGA
CTGCCTCCTCTGGGAACCTCAACACCCTGAGCAGCCTCCACCCAATGGGAGGGTTGAATGCAATGCAGTT
ACAGAATTTGGCTGCACTAGCTGCTGCAGCTAGTGCAGCTCAGAACACACCAAGTGGTACCAATGCTCTC
ACTACATCCAGCAGTCCCCTCAGCGTGCTCACTAGTTCAGCAGGGTCCTCACCTAGCTCTAGCAGCAGTA
ATTCTGTCAACCCCATAGCCTCACTTGGAGCCCTGCAGACATTAGCTGGAGCAACGGCTGGCCTCAATGT
TGGCTCTTTGGCAGGAATGGCTGCTTTAAATGGTGGCCTGGGCAGCAGTGGCCTTTCCAATGGCACCGGG
AGCACCATGGAGGCCCTCACTCAGGCCTACTCGGGTATCCAGCAATATGCTGCTGCTGCGCTCCCCACTC
TGTACAACCAGAATCTTCTGACACAGCAGAGTATTGGTGCTGCTGGAAGCCAGAAGGAAGGTCCAGAGGG
AGCCAACCTGTTCATCTACCACCTGCCCCAGGAGTTTGGTGATCAGGACCTGCTGCAGATGTTTATGCCC
TTTGGGAATGTCGTGTCTGCCAAGGTTTTCATAGACAAGCAGACAAACCTGAGCAAGTGTTTTGGTTTTG
TAAGTTACGACAATCCTGTTTCGGCCCAAGCTGCCATCCAGTCCATGAACGGCTTTCAGATTGGCATGAA
GCGGCTTAAAGTGCAGCTCAAACGTTCGAAGAATGACAGCAAGCCCTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206275 representing NM_006560
Red=Cloning site Green=Tags(s)

MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRK
AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRIL
RGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISA
ASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNAL
TTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTG
STMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMP
FGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006560
ORF Size 1449 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006560.1, NM_006560.2, NM_006560.3, NP_006551
RefSeq Size 2157
RefSeq ORF 1449
Locus ID 10658
Cytogenetics 11p11.2
Domains RRM
Protein Families Druggable Genome
MW 51.4 kDa
Gene Summary Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations