FRS2 (NM_006654) Human Tagged ORF Clone

CAT#: RC205842

Reviews ()
Write a review

FRS2 (Myc-DDK-tagged)-Human fibroblast growth factor receptor substrate 2 (FRS2), transcript variant 1



  "NM_006654" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "FRS2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol FRS2
Synonyms FRS1A; FRS2A; FRS2alpha; SNT; SNT-1; SNT1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205842 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCA
TTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTT
ATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTATGACTCGAAT
CTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAGTGTGCCCGTG
CAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGT
TGTAGAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGA
TTTGCTGCTCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGT
CAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCT
TGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCAAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTA
GTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCC
TGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGA
GCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCTGTTAACAAAC
TGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATC
CACCAGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAA
AATCTACCATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGAC
CAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAA
TGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTG
GCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCG
CACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCA
CGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTTAGCCTGGAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205842 protein sequence
Red=Cloning site Green=Tags(s)

MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSN
LFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPG
FAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGEESTHPLLVAEEQVHTYVNTTGVQEERKNRT
SVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSG
ANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYE
NLPSLPPVWEARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALP
RDDGTSRKTRHNSTDLPMLAWK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006654
ORF Size 1536 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006654.2, NP_006645.2
RefSeq Size 6883 bp
RefSeq ORF 1527 bp
Locus ID 10818
UniProt ID Q8WU20
Cytogenetics 12q15
Domains IRS
Protein Families Druggable Genome
Protein Pathways Neurotrophin signaling pathway
MW 57.5 kDa
Gene Summary Adapter protein that links activated FGR and NGF receptors to downstream signaling pathways. Plays an important role in the activation of MAP kinases and in the phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, in response to ligand-mediated activation of FGFR1. Modulates signaling via SHC1 by competing for a common binding site on NTRK1.[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.