ARF4 (NM_001660) Human Tagged ORF Clone

CAT#: RC204984

ARF4 (Myc-DDK-tagged)-Human ADP-ribosylation factor 4 (ARF4)

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name ARF4 (NM_001660) Human Tagged ORF Clone
Symbol ARF4
Synonyms ARF2; ARF2
Vector pCMV6-Entry
Sequence Data
>RC204984 representing NM_001660
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCTCACTATCTCCTCCCTCTTCTCCCGACTATTTGGCAAGAAGCAGATGCGCATTTTGATGGTTG
GATTGGATGCTGCTGGCAAGACAACCATTCTGTATAAACTGAAGTTAGGGGAGATAGTCACCACCATTCC
TACCATTGGTTTTAATGTGGAAACAGTAGAATATAAGAACATTTGTTTCACAGTATGGGATGTTGGTGGT
CAAGATAGAATTAGGCCTCTCTGGAAGCATTACTTCCAGAATACCCAGGGTCTTATTTTTGTGGTAGATA
GCAACGATCGTGAAAGAATTCAGGAAGTAGCAGATGAGCTGCAGAAAATGCTTCTGGTAGATGAATTGAG
AGATGCAGTGCTGCTACTTTTTGCAAACAAACAGGATTTGCCAAATGCTATGGCCATCAGTGAAATGACA
GATAAACTAGGGCTTCAGTCTCTTCGTAACAGAACATGGTATGTTCAAGCCACTTGTGCAACACAAGGAA
CTGGTCTGTATGAAGGACTTGACTGGCTGTCAAATGAGCTTTCAAAACGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204984 representing NM_001660
Red=Cloning site Green=Tags(s)

MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG
QDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMT
DKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001660
ORF Size 540 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001660.1, NM_001660.2, NM_001660.3, NP_001651
RefSeq Size 1610
RefSeq ORF 543
Locus ID 378
Cytogenetics 3p14.3
Domains RAB, SAR, ARF, arf
MW 20.3 kDa
Gene Summary This gene is a member of the human ARF gene family whose members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 5 ARF proteins and 11 ARF-like proteins and constitute one family of the RAS superfamily. The ARF proteins are categorized as class I, class II and class III; this gene is a class II member. The members of each class share a common gene organization. The ARF4 gene spans approximately 12kb and contains six exons and five introns. This gene is the most divergent member of the human ARFs. Conflicting map positions at 3p14 or 3p21 have been reported for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)