CHRNA6 (NM_004198) Human Tagged ORF Clone

CAT#: RC204868

CHRNA6 (Myc-DDK-tagged)-Human cholinergic receptor, nicotinic, alpha 6 (CHRNA6), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CHRNA6 (NM_004198) Human Tagged ORF Clone
Symbol CHRNA6
Synonyms CHNRA6; CHNRA6
Vector pCMV6-Entry
Sequence Data
>RC204868 representing NM_004198
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGACCAGCAAGGGGCAGGGATTCCTTCATGGGGGCTTGTGTCTCTGGCTGTGTGTGTTCACACCTT
TCTTTAAAGGCTGTGTGGGCTGTGCAACTGAGGAGAGGCTCTTCCACAAACTGTTTTCTCATTACAACCA
GTTCATCAGGCCTGTGGAAAACGTTTCCGACCCTGTCACGGTACACTTTGAAGTGGCCATCACCCAGCTG
GCCAACGTGGATGAAGTAAACCAGATCATGGAAACCAATTTGTGGCTGCGTCACATCTGGAATGATTATA
AATTGCGCTGGGATCCAATGGAATATGATGGCATTGAGACTCTTCGCGTTCCTGCAGATAAGATTTGGAA
GCCCGACATTGTTCTCTATAACAATGCTGTTGGTGACTTCCAAGTAGAAGGCAAAACAAAAGCTCTTCTT
AAATACAATGGCATGATAACCTGGACTCCACCAGCTATTTTTAAGAGTTCCTGCCCTATGGATATCACCT
TTTTCCCTTTTGATCATCAAAACTGTTCCCTAAAATTTGGTTCCTGGACGTATGACAAAGCTGAAATTGA
TCTTCTAATCATTGGATCAAAAGTGGATATGAATGATTTTTGGGAAAACAGTGAATGGGAAATCATTGAT
GCCTCTGGCTACAAACATGACATCAAATACAACTGTTGTGAAGAGATATACACAGATATAACCTATTCTT
TCTACATTAGAAGATTGCCGATGTTTTACACGATTAATCTGATCATCCCTTGTCTCTTTATTTCATTTCT
AACCGTGTTGGTCTTTTACCTTCCTTCGGACTGTGGTGAAAAAGTGACGCTTTGTATTTCAGTCCTGCTT
TCTCTGACTGTGTTTTTGCTGGTCATCACAGAAACCATCCCATCCACATCTCTGGTGGTCCCACTGGTGG
GTGAGTACCTGCTGTTCACCATGATCTTTGTCACACTGTCCATCGTGGTGACTGTGTTTGTGTTGAACAT
ACACTACCGCACCCCAACCACGCACACAATGCCCAGGTGGGTGAAGACAGTTTTCCTGAAGCTGCTGCCC
CAGGTCCTGCTGATGAGGTGGCCTCTGGACAAGACAAGGGGCACAGGCTCTGATGCAGTGCCCAGAGGCC
TTGCCAGGAGGCCTGCCAAAGGCAAGCTTGCAAGCCATGGGGAACCCAGACATCTTAAAGAATGCTTCCA
TTGTCACAAATCAAATGAGCTTGCCACAAGCAAGAGAAGATTAAGTCATCAGCCATTACAGTGGGTGGTG
GAAAATTCGGAGCACTCGCCTGAAGTTGAAGATGTGATTAACAGTGTTCAGTTCATAGCAGAAAACATGA
AGAGCCACAATGAAACCAAGGAGGTAGAAGATGACTGGAAATACGTGGCCATGGTGGTGGACAGAGTATT
TCTTTGGGTATTTATAATTGTCTGTGTATTTGGAACTGCAGGGCTATTTCTACAGCCACTACTTGGGAAC
ACAGGAAAATCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204868 representing NM_004198
Red=Cloning site Green=Tags(s)

MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVTVHFEVAITQL
ANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALL
KYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIID
ASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLL
SLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLP
QVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVV
ENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTAGLFLQPLLGN
TGKS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004198
ORF Size 1482 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004198.1, NM_004198.2, NM_004198.3, NP_004189
RefSeq Size 2090
RefSeq ORF 1485
Locus ID 8973
Cytogenetics 8p11.21
Protein Families Ion Channels: Cys-loop Receptors, Transmembrane, Druggable Genome
MW 56.7 kDa
Gene Summary This gene encodes an alpha subunit of neuronal nicotinic acetylcholine receptors. These receptors consist of five subunits and function as ion channels involved in neurotransmission. The encoded protein is a subunit of neuronal nicotinic acetylcholine receptors that mediate dopaminergic neurotransmission and are activated by acetylcholine and exogenous nicotine. Alternatively spliced transcript variants have been observed for this gene. Single nucleotide polymorphisms in this gene have been associated with both nicotine and alcohol dependence. [provided by RefSeq, Dec 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)