xCT (SLC7A11) (NM_014331) Human Tagged ORF Clone

CAT#: RC204136

Reviews ()
Write a review
  • TrueORF®

SLC7A11 (Myc-DDK-tagged)-Human solute carrier family 7, (cationic amino acid transporter, y+ system) member 11 (SLC7A11)



  "NM_014331" in other vectors (6)

Reconstitution Protocol

USD 466.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "SLC7A11"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SLC7A11
Synonyms CCBR1; xCT
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204136 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCAGAAAGCCTGTTGTGTCCACCATCTCCAAAGGAGGTTACCTGCAGGGAAATGTTAACGGGAGGC
TGCCTTCCCTGGGCAACAAGGAGCCACCTGGGCAGGAGAAAGTGCAGCTGAAGAGGAAAGTCACTTTACT
GAGGGGAGTCTCCATTATCATTGGCACCATCATTGGAGCAGGAATCTTCATCTCTCCTAAGGGCGTGCTC
CAGAACACGGGCAGCGTGGGCATGTCTCTGACCATCTGGACGGTGTGTGGGGTCCTGTCACTATTTGGAG
CTTTGTCTTATGCTGAATTGGGAACAACTATAAAGAAATCTGGAGGTCATTACACATATATTTTGGAAGT
CTTTGGTCCATTACCAGCTTTTGTACGAGTCTGGGTGGAACTCCTCATAATACGCCCTGCAGCTACTGCT
GTGATATCCCTGGCATTTGGACGCTACATTCTGGAACCATTTTTTATTCAATGTGAAATCCCTGAACTTG
CGATCAAGCTCATTACAGCTGTGGGCATAACTGTAGTGATGGTCCTAAATAGCATGAGTGTCAGCTGGAG
CGCCCGGATCCAGATTTTCTTAACCTTTTGCAAGCTCACAGCAATTCTGATAATTATAGTCCCTGGAGTT
ATGCAGCTAATTAAAGGTCAAACGCAGAACTTTAAAGACGCCTTTTCAGGAAGAGATTCAAGTATTACGC
GGTTGCCACTGGCTTTTTATTATGGAATGTATGCATATGCTGGCTGGTTTTACCTCAACTTTGTTACTGA
AGAAGTAGAAAACCCTGAAAAAACCATTCCCCTTGCAATATGTATATCCATGGCCATTGTCACCATTGGC
TATGTGCTGACAAATGTGGCCTACTTTACGACCATTAATGCTGAGGAGCTGCTGCTTTCAAATGCAGTGG
CAGTGACCTTTTCTGAGCGGCTACTGGGAAATTTCTCATTAGCAGTTCCGATCTTTGTTGCCCTCTCCTG
CTTTGGCTCCATGAACGGTGGTGTGTTTGCTGTCTCCAGGTTATTCTATGTTGCGTCTCGAGAGGGTCAC
CTTCCAGAAATCCTCTCCATGATTCATGTCCGCAAGCACACTCCTCTACCAGCTGTTATTGTTTTGCACC
CTTTGACAATGATAATGCTCTTCTCTGGAGACCTCGACAGTCTTTTGAATTTCCTCAGTTTTGCCAGGTG
GCTTTTTATTGGGCTGGCAGTTGCTGGGCTGATTTATCTTCGATACAAATGCCCAGATATGCATCGTCCT
TTCAAGGTGCCACTGTTCATCCCAGCTTTGTTTTCCTTCACATGCCTCTTCATGGTTGCCCTTTCCCTCT
ATTCGGACCCATTTAGTACAGGGATTGGCTTCGTCATCACTCTGACTGGAGTCCCTGCGTATTATCTCTT
TATTATATGGGACAAGAAACCCAGGTGGTTTAGAATAATGTCAGAGAAAATAACCAGAACATTACAAATA
ATACTGGAAGTTGTACCAGAAGAAGATAAGTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204136 protein sequence
Red=Cloning site Green=Tags(s)

MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVL
QNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATA
VISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGV
MQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIG
YVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGH
LPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRP
FKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQI
ILEVVPEEDKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014331
ORF Size 1503 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014331.3, NP_055146.1
RefSeq Size 9648 bp
RefSeq ORF 1506 bp
Locus ID 23657
UniProt ID Q9UPY5
Cytogenetics 4q28.3
Domains aa_permeases
Protein Families Druggable Genome, Transmembrane
MW 55.4 kDa
Gene Summary This gene encodes a member of a heteromeric, sodium-independent, anionic amino acid transport system that is highly specific for cysteine and glutamate. In this system, designated Xc(-), the anionic form of cysteine is transported in exchange for glutamate. This protein has been identified as the predominant mediator of Kaposi sarcoma-associated herpesvirus fusion and entry permissiveness into cells. Also, increased expression of this gene in primary gliomas (compared to normal brain tissue) was associated with increased glutamate secretion via the XCT channels, resulting in neuronal cell death. [provided by RefSeq, Sep 2011]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.