CYLD (NM_001042355) Human Tagged ORF Clone

CAT#: RC204099

CYLD (Myc-DDK-tagged)-Human cylindromatosis (turban tumor syndrome) (CYLD), transcript variant 2

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name CYLD (NM_001042355) Human Tagged ORF Clone
Symbol CYLD
Synonyms BRSS; CDMT; CYLD1; CYLDI; EAC; MFT; MFT1; SBS; TEM; USPL2
Vector pCMV6-Entry
Sequence Data
>RC204099 representing NM_001042355
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTTCAGGCTTATGGAGCCAAGAAAAAGTCACTTCACCCTACTGGGAAGAGCGGATTTTTTACTTGC
TTCTTCAAGAATGCAGCGTTACAGACAAACAAACACAAAAGCTCCTTAAAGTACCGAAGGGAAGTATAGG
ACAGTATATTCAAGATCGTTCTGTGGGGCATTCAAGGATTCCTTCTGCAAAAGGCAAGAAAAATCAGATT
GGATTAAAAATTCTAGAGCAACCTCATGCAGTTCTCTTTGTTGATGAAAAGGATGTTGTAGAGATAAATG
AAAAGTTCACAGAGTTACTTTTGGCAATTACCAATTGTGAGGAGAGGTTCAGCCTGTTTAAAAACAGAAA
CAGACTAAGTAAAGGCCTCCAAATAGACGTGGGCTGTCCTGTGAAAGTACAGCTGAGATCTGGGGAAGAA
AAATTTCCTGGAGTTGTACGCTTCAGAGGACCCCTGTTAGCAGAGAGGACAGTCTCCGGAATATTCTTTG
GAGTTGAATTGCTGGAAGAAGGTCGTGGTCAAGGTTTCACTGACGGGGTGTACCAAGGGAAACAGCTTTT
TCAGTGTGATGAAGATTGTGGCGTGTTTGTTGCATTGGACAAGCTAGAACTCATAGAAGATGATGACACT
GCATTGGAAAGTGATTACGCAGGTCCTGGGGACACAATGCAGGTCGAACTTCCTCCTTTGGAAATAAACT
CCAGAGTTTCTTTGAAGGTTGGAGAAACAATAGAATCTGGAACAGTTATATTCTGTGATGTTTTGCCAGG
AAAAGAAAGCTTAGGATATTTTGTTGGTGTGGACATGGATAACCCTATTGGCAACTGGGATGGAAGATTT
GATGGAGTGCAGCTTTGTAGTTTTGCGTGTGTTGAAAGTACAATTCTATTGCACATCAATGATATCATCC
CAGAGAGTGTGACGCAGGAAAGGAGGCCTCCCAAACTTGCCTTTATGTCAAGAGGTGTTGGGGACAAAGG
TTCATCCAGTCATAATAAACCAAAGGCTACAGGATCTACCTCAGACCCTGGAAATAGAAACAGATCTGAA
TTATTTTATACCTTAAATGGGTCTTCTGTTGACTCACAACCACAATCCAAATCAAAAAATACATGGTACA
TTGATGAAGTTGCAGAAGACCCTGCAAAATCTCTTACAGAGATATCTACAGACTTTGACCGTTCTTCACC
ACCACTCCAGCCTCCTCCTGTGAACTCACTGACCACCGAGAACAGATTCCACTCTTTACCATTCAGTCTC
ACCAAGATGCCCAATACCAATGGAAGTATTGGCCACAGTCCACTTTCTCTGTCAGCCCAGTCTGTAATGG
AAGAGCTAAACACTGCACCCGTCCAAGAGAGTCCACCCTTGGCCATGCCTCCTGGGAACTCACATGGTCT
AGAAGTGGGCTCATTGGCTGAAGTTAAGGAGAACCCTCCTTTCTATGGGGTAATCCGTTGGATCGGTCAG
CCACCAGGACTGAATGAAGTGCTCGCTGGACTGGAACTGGAAGATGAGTGTGCAGGCTGTACGGATGGAA
CCTTCAGAGGCACTCGGTATTTCACCTGTGCCCTGAAGAAGGCGCTGTTTGTGAAACTGAAGAGCTGCAG
GCCTGACTCTAGGTTTGCATCATTGCAGCCGGTTTCCAATCAGATTGAGCGCTGTAACTCTTTAGCATTT
GGAGGCTACTTAAGTGAAGTAGTAGAAGAAAATACTCCACCAAAAATGGAAAAAGAAGGCTTGGAGATAA
TGATTGGGAAGAAGAAAGGCATCCAGGGTCATTACAATTCTTGTTACTTAGACTCAACCTTATTCTGCTT
ATTTGCTTTTAGTTCTGTTCTGGACACTGTGTTACTTAGACCCAAAGAAAAGAACGATGTAGAATATTAT
AGTGAAACCCAAGAGCTACTGAGGACAGAAATTGTTAATCCTCTGAGAATATATGGATATGTGTGTGCCA
CAAAAATTATGAAACTGAGGAAAATACTTGAAAAGGTGGAGGCTGCATCAGGATTTACCTCTGAAGAAAA
AGATCCTGAGGAATTCTTGAATATTCTGTTTCATCATATTTTAAGGGTAGAACCTTTGCTAAAAATAAGA
TCAGCAGGTCAAAAGGTACAAGATTGTTACTTCTATCAAATTTTTATGGAAAAAAATGAGAAAGTTGGCG
TTCCCACAATTCAGCAGTTGTTAGAATGGTCTTTTATCAACAGTAACCTGAAATTTGCAGAGGCACCATC
ATGTCTGATTATTCAGATGCCTCGATTTGGAAAAGACTTTAAACTATTTAAAAAAATTTTTCCTTCTCTG
GAATTAAATATAACAGATTTACTTGAAGACACTCCCAGACAGTGCCGGATATGTGGAGGGCTTGCAATGT
ATGAGTGTAGAGAATGCTACGACGATCCGGACATCTCAGCTGGAAAAATCAAGCAGTTTTGTAAAACCTG
CAACACTCAAGTCCACCTTCATCCGAAGAGGCTGAATCATAAATATAACCCAGTGTCACTTCCCAAAGAC
TTACCCGACTGGGACTGGAGACACGGCTGCATCCCTTGCCAGAATATGGAGTTATTTGCTGTTCTCTGCA
TAGAAACAAGCCACTATGTTGCTTTTGTGAAGTATGGGAAGGACGATTCTGCCTGGCTCTTCTTTGACAG
CATGGCCGATCGGGATGGTGGTCAGAATGGCTTCAACATTCCTCAAGTCACCCCATGCCCAGAAGTAGGA
GAGTACTTGAAGATGTCTCTGGAAGACCTGCATTCCTTGGACTCCAGGAGAATCCAAGGCTGTGCACGAA
GACTGCTTTGTGATGCATATATGTGCATGTACCAGAGTCCAACAATGAGTTTGTACAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204099 representing NM_001042355
Red=Cloning site Green=Tags(s)

MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRIPSAKGKKNQI
GLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVKVQLRSGEE
KFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGVYQGKQLFQCDEDCGVFVALDKLELIEDDDT
ALESDYAGPGDTMQVELPPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRF
DGVQLCSFACVESTILLHINDIIPESVTQERRPPKLAFMSRGVGDKGSSSHNKPKATGSTSDPGNRNRSE
LFYTLNGSSVDSQPQSKSKNTWYIDEVAEDPAKSLTEISTDFDRSSPPLQPPPVNSLTTENRFHSLPFSL
TKMPNTNGSIGHSPLSLSAQSVMEELNTAPVQESPPLAMPPGNSHGLEVGSLAEVKENPPFYGVIRWIGQ
PPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFASLQPVSNQIERCNSLAF
GGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRPKEKNDVEYY
SETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIR
SAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSL
ELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKD
LPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVG
EYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001042355
ORF Size 2859 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001042355.1, NP_001035814
RefSeq Size 8584
RefSeq ORF 2862
Locus ID 1540
Cytogenetics 16q12.1
Protein Families Druggable Genome
Protein Pathways RIG-I-like receptor signaling pathway
MW 106.9 kDa
Gene Summary This gene is encodes a cytoplasmic protein with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains that functions as a deubiquitinating enzyme. Mutations in this gene have been associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)