FKBP10 (NM_021939) Human Tagged ORF Clone

CAT#: RC203676

FKBP10 (Myc-DDK-tagged)-Human FK506 binding protein 10, 65 kDa (FKBP10)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FKBP10 (NM_021939) Human Tagged ORF Clone
Symbol FKBP10
Synonyms BRKS1; FKBP65; hFKBP65; OI11; OI6; PPIASE
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC203676 representing NM_021939
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCCCCGCGGGCCCCCCCAGCCACAGCCTCCTCCGGCTCCCCCTGCTGCAGTTGCTGCTACTGGTGG
TGCAGGCCGTGGGGAGGGGGCTGGGCCGCGCCAGCCCGGCCGGGGGCCCCCTGGAAGATGTGGTCATCGA
GAGGTACCACATCCCCAGGGCCTGTCCCCGGGAAGTGCAGATGGGGGATTTTGTGCGCTACCACTACAAC
GGCACTTTTGAAGATGGCAAGAAGTTTGATTCAAGCTATGATCGCAACACCTTGGTGGCCATCGTGGTGG
GTGTGGGGCGCCTCATCACTGGCATGGACCGAGGCCTCATGGGCATGTGTGTCAACGAGCGGCGACGCCT
CATTGTGCCTCCCCACCTGGGCTATGGGAGCATCGGCCTGGCGGGGCTCATTCCACCGGATGCCACCCTC
TACTTCGATGTGGTTCTGCTGGATGTGTGGAACAAGGAAGACACCGTGCAGGTGAGCACATTGCTGCGCC
CGCCCCACTGCCCCCGCATGGTCCAGGACGGCGACTTTGTCCGCTACCACTACAATGGCACCCTGCTGGA
CGGCACCTCCTTCGACACCAGCTACAGTAAGGGCGGCACTTATGACACCTACGTCGGCTCTGGTTGGCTG
ATCAAGGGCATGGACCAGGGGCTGCTGGGCATGTGTCCTGGAGAGAGAAGGAAGATTATCATCCCTCCAT
TCCTGGCCTATGGCGAGAAAGGCTATGGGACAGTGATCCCCCCACAGGCCTCGCTGGTCTTTCACGTCCT
CCTGATTGACGTGCACAACCCGAAGGACGCTGTCCAGCTAGAGACGCTGGAGCTCCCCCCCGGCTGTGTC
CGCAGAGCCGGGGCCGGGGACTTCATGCGCTACCACTACAATGGCTCCTTGATGGACGGCACCCTCTTCG
ATTCCAGCTACTCCCGCAACCACACCTACAATACCTATATCGGGCAGGGTTACATCATCCCCGGGATGGA
CCAGGGGCTGCAGGGTGCCTGCATGGGGGAACGCCGGAGAATTACCATCCCCCCGCACCTCGCCTATGGG
GAGAATGGAACTGGAGACAAGATCCCTGGCTCTGCCGTGCTAATCTTCAACGTCCATGTCATTGACTTCC
ACAACCCTGCGGATGTGGTGGAAATCAGGACACTGTCCCGGCCATCTGAGACCTGCAATGAGACCACCAA
GCTTGGGGACTTTGTTCGATACCATTACAACTGTTCTTTGCTGGACGGCACCCAGCTGTTCACCTCGCAT
GACTACGGGGCCCCCCAGGAGGCGACTCTCGGGGCCAACAAGGTGATCGAAGGCCTGGACACGGGCCTGC
AGGGCATGTGTGTGGGAGAGAGGCGGCAGCTCATCGTGCCCCCGCACCTGGCCCACGGGGAGAGTGGAGC
CCGGGGAGTCCCAGGCAGTGCTGTGCTGCTGTTTGAGGTGGAGCTGGTGTCCCGGGAGGATGGGCTGCCC
ACAGGCTACCTGTTTGTGTGGCACAAGGACCCTCCTGCCAACCTGTTTGAAGACATGGACCTCAACAAGG
ATGGCGAGGTCCCTCCGGAGGAGTTCTCCACCTTCATCAAGGCTCAAGTGAGTGAGGGCAAAGGACGCCT
CATGCCTGGGCAGGACCCTGAGAAAACCATAGGAGACATGTTCCAGAACCAGGACCGCAACCAGGACGGC
AAGATCACAGTCGACGAGCTCAAGCTGAAGTCAGATGAGGACGAGGAGCGGGTCCACGAGGAGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203676 representing NM_021939
Red=Cloning site Green=Tags(s)

MFPAGPPSHSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQMGDFVRYHYN
GTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVPPHLGYGSIGLAGLIPPDATL
YFDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDGDFVRYHYNGTLLDGTSFDTSYSKGGTYDTYVGSGWL
IKGMDQGLLGMCPGERRKIIIPPFLAYGEKGYGTVIPPQASLVFHVLLIDVHNPKDAVQLETLELPPGCV
RRAGAGDFMRYHYNGSLMDGTLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACMGERRRITIPPHLAYG
ENGTGDKIPGSAVLIFNVHVIDFHNPADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSH
DYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEVELVSREDGLP
TGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDG
KITVDELKLKSDEDEERVHEEL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021939
ORF Size 1746 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021939.2, NM_021939.3, NP_068758
RefSeq Size 2641
RefSeq ORF 1749
Locus ID 60681
Cytogenetics 17q21.2
Protein Families Druggable Genome
MW 64.1 kDa
Gene Summary The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. This protein localizes to the endoplasmic reticulum and acts as a molecular chaperone. Alternatively spliced variants encoding different isoforms have been reported, but their biological validity has not been determined.[provided by RefSeq, Nov 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations