ACTC1 (NM_005159) Human Tagged ORF Clone

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ACTC1 (NM_005159) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ACTC1
Synonyms ACTC; ASD5; CMD1R; CMH11; LVNC4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC203655 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGTGACGACGAGGAGACCACCGCCCTGGTGTGCGACAACGGCTCTGGGCTGGTGAAGGCCGGCTTTG
CGGGCGATGACGCGCCCCGCGCTGTCTTCCCGTCCATCGTGGGCCGCCCGCGGCACCAGGGAGTTATGGT
GGGTATGGGTCAGAAGGACTCCTACGTAGGTGATGAAGCCCAGAGCAAGAGAGGCATCCTGACCCTGAAG
TATCCCATCGAGCATGGTATCATCACCAACTGGGACGACATGGAGAAGATCTGGCACCACACCTTCTACA
ATGAGCTCCGTGTGGCTCCCGAGGAGCACCCCACCCTGCTCACAGAGGCCCCGCTGAACCCCAAGGCCAA
CCGGGAGAAGATGACTCAGATCATGTTTGAGACCTTCAATGTCCCTGCCATGTACGTGGCCATCCAGGCA
GTGCTATCCCTGTATGCTTCTGGCCGTACCACAGGCATTGTTCTGGACTCTGGGGATGGTGTAACTCACA
ATGTCCCCATCTATGAGGGCTACGCTTTGCCCCATGCCATCATGCGTCTGGATCTGGCTGGTCGGGACCT
CACTGACTACCTCATGAAGATCCTCACTGAGCGTGGCTACTCCTTTGTCACCACTGCTGAACGTGAAATT
GTCCGTGACATTAAAGAGAAGCTGTGCTATGTCGCCCTGGATTTTGAGAATGAGATGGCCACAGCTGCCT
CTTCCTCCTCCCTGGAGAAGAGCTATGAACTGCCTGATGGCCAAGTCATCACTATTGGCAATGAGCGCTT
CCGCTGTCCTGAGACACTCTTCCAGCCCTCCTTCATTGGTATGGAATCTGCTGGCATCCATGAAACAACT
TACAATAGCATCATGAAGTGTGACATTGATATCCGCAAGGACCTGTATGCCAACAATGTCTTATCTGGAG
GCACCACTATGTACCCTGGTATTGCTGATCGTATGCAGAAGGAAATCACTGCTCTGGCTCCTAGCACCAT
GAAGATTAAGATTATTGCTCCCCCTGAGCGTAAATACTCTGTCTGGATTGGGGGCTCCATCCTGGCCTCT
CTGTCCACCTTCCAGCAAATGTGGATTAGCAAGCAAGAGTACGATGAGGCAGGCCCATCCATTGTCCACC
GCAAATGCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203655 protein sequence
Red=Cloning site Green=Tags(s)

MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK
YPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA
VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI
VRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETT
YNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS
LSTFQQMWISKQEYDEAGPSIVHRKCF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005159
ORF Size 1131 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005159.1, NM_005159.2, NM_005159.3, NM_005159.4, NM_005159.5, NP_005150.1
RefSeq Size 3693 bp
RefSeq ORF 1134 bp
Locus ID 70
Cytogenetics 15q14
Domains ACTIN
Protein Pathways Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)
MW 42 kDa
Gene Summary Actins are highly conserved proteins that are involved in various types of cell motility. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to four others. The protein encoded by this gene belongs to the actin family which is comprised of three main groups of actin isoforms, alpha, beta, and gamma. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. Defects in this gene have been associated with idiopathic dilated cardiomyopathy (IDC) and familial hypertrophic cardiomyopathy (FHC). [provided by RefSeq, Jul 2008]

Other Versions

Other products for "ACTC1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit monoclonal antibody against Actin (Pan)(EP184E)
    • 100 ul

USD 524.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools