CISD1 (NM_018464) Human Tagged ORF Clone

CAT#: RC203308

CISD1 (Myc-DDK-tagged)-Human CDGSH iron sulfur domain 1 (CISD1)

Change vector?

USD 98

USD 390


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CISD1 (NM_018464) Human Tagged ORF Clone
Symbol CISD1
Synonyms C10orf70; MDS029; mitoNEET; ZCD1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC203308 representing NM_018464
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTCTGACTTCCAGTTCCAGCGTACGAGTTGAATGGATCGCAGCAGTTACCATTGCTGCTGGGACAG
CTGCAATTGGTTATCTAGCTTACAAAAGATTTTATGTTAAAGATCATCGAAATAAAGCTATGATAAACCT
TCACATCCAGAAAGACAACCCCAAGATAGTACATGCTTTTGACATGGAGGATTTGGGAGATAAAGCTGTG
TACTGCCGTTGTTGGAGGTCCAAAAAGTTCCCATTCTGTGATGGGGCTCACACAAAACATAACGAAGAGA
CTGGAGACAATGTGGGCCCTCTGATCATCAAGAAAAAAGAAACT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203308 representing NM_018464
Red=Cloning site Green=Tags(s)

MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAV
YCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_018464
ORF Size 324 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_018464.1, NM_018464.2, NM_018464.3, NM_018464.4, NP_060934
RefSeq Size 925
RefSeq ORF 327
Locus ID 55847
Cytogenetics 10q21.1
Domains ZnF_CDGSH
Protein Families Transmembrane
MW 12 kDa
Gene Summary This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2. [provided by RefSeq, Feb 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations