Ube1L (UBA7) (NM_003335) Human Tagged ORF Clone

CAT#: RC202883

Reviews ()
Write a review

UBA7 (Myc-DDK-tagged)-Human ubiquitin-like modifier activating enzyme 7 (UBA7)



  "NM_003335" in other vectors (6)

Reconstitution Protocol

USD 881.00

USD 1,321.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "UBA7"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol UBA7
Synonyms D8; UBA1B; UBE1L; UBE2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202883 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGCCCTGGACGCTTCGAAGCTACTGGATGAGGAGCTGTATTCAAGACAGCTGTATGTGCTGGGCT
CACCTGCCATGCAGAGGATTCAGGGAGCCAGGGTCCTGGTGTCAGGCCTGCAGGGCCTGGGGGCCGAGGT
GGCCAAGAACTTGGTTCTGATGGGTGTGGGCAGCCTCACTCTGCATGATCCCCACCCCACCTGCTGGTCC
GACCTGGCTGCCCAGTTTCTCCTCTCAGAGCAGGACTTGGAAAGGAGCAGAGCCGAGGCCTCTCAAGAGC
TCTTGGCTCAGCTCAACAGAGCTGTCCAGGTCGTCGTGCACACGGGTGACATCACTGAGGACCTGCTGTT
GGACTTCCAGGTGGTGGTGCTGACTGCTGCAAAGCTGGAGGAGCAGCTGAAGGTGGGCACCTTGTGTCAT
AAGCATGGAGTTTGCTTTCTGGCGGCTGACACCCGGGGCCTCGTGGGGCAGTTGTTCTGTGACTTTGGTG
AGGACTTCACTGTGCAGGACCCCACAGAGGCAGAACCCCTGACAGCTGCCATCCAGCACATCTCCCAGGG
CTCCCCTGGCATTCTCACTCTGAGGAAAGGGGCCAATACCCACTACTTCCGTGATGGAGACTTGGTGACT
TTCTCGGGAATTGAGGGAATGGTTGAGCTCAACGACTGTGATCCCCGGTCTATCCACGTGCGGGAGGATG
GGTCCCTGGAGATTGGAGACACAACAACTTTCTCTCGGTACTTGCGTGGTGGGGCTATCACTGAAGTCAA
GAGACCCAAGACTGTGAGACATAAGTCCCTGGACACAGCCCTGCTCCAGCCCCATGTGGTGGCCCAGAGC
TCCCAGGAAGTTCACCATGCCCACTGCCTGCATCAGGCCTTCTGTGCACTGCACAAGTTCCAGCACCTCC
ATGGCCGGCCACCCCAGCCCTGGGATCCTGTTGATGCAGAGACTGTGGTGGGCCTGGCCCGGGACCTGGA
ACCACTGAAGCGGACAGAGGAAGAGCCACTGGAAGAGCCACTGGATGAGGCCCTAGTGCGGACAGTCGCC
CTAAGCAGTGCAGGTGTCTTGAGCCCTATGGTGGCCATGCTGGGTGCAGTAGCTGCCCAGGAAGTGCTGA
AGGCAATCTCCAGGAAGTTCATGCCTCTGGACCAGTGGCTTTACTTTGATGCCCTCGATTGTCTTCCGGA
AGATGGGGAGCTCCTTCCCAGTCCTGAGGACTGTGCCCTGAGAGGCAGCCGCTATGATGGGCAAATTGCA
GTGTTTGGGGCTGGTTTTCAGGAGAAACTGAGACGCCAGCACTACCTCCTGGTGGGCGCTGGTGCCATTG
GTTGTGAGCTGCTCAAAGTCTTTGCCCTAGTGGGACTGGGGGCCGGGAACAGCGGGGGCTTGACTGTTGT
TGACATGGACCACATAGAGCGCTCCAATCTCAGCCGTCAGTTCCTCTTCAGGTCCCAGGACGTTGGTAGA
CCCAAGGCAGAGGTGGCTGCAGCAGCTGCCCGGGGCCTGAACCCAGACTTACAGGTGATCCCGCTCACCT
ACCCACTGGATCCCACCACAGAGCACATCTATGGGGATAACTTTTTCTCCCGTGTGGATGGTGTGGCTGC
TGCCCTGGACAGTTTCCAGGCCCGGCGCTATGTGGCTGCTCGTTGCACCCACTATCTGAAGCCACTGCTG
GAGGCAGGCACATCGGGCACCTGGGGCAGTGCTACAGTATTCATGCCACATGTGACTGAGGCCTACAGAG
CCCCTGCCTCAGCTGCAGCTTCTGAGGATGCCCCCTACCCTGTCTGTACCGTGCGGTACTTCCCTAGCAC
AGCCGAGCACACCCTGCAGTGGGCCCGGCATGAGTTTGAAGAACTCTTCCGACTGTCTGCAGAGACCATC
AACCACCACCAACAGGCACACACTTCCCTGGCAGACATGGATGAGCCACAGACACTCACCTTACTGAAGC
CAGTGCTTGGGGTCCTGAGAGTGCGTCCACAGAACTGGCAAGACTGTGTGGCGTGGGCTCTTGGCCACTG
GAAACTCTGCTTTCATTATGGCATCAAACAGCTGCTGAGGCACTTCCCACCTAATAAAGTGCTTGAGGAT
GGAACTCCCTTCTGGTCAGGTCCCAAACAGTGTCCCCAGCCCTTGGAGTTTGACACCAACCAAGACACAC
ACCTCCTCTACGTACTGGCAGCTGCCAACCTGTATGCCCAGATGCATGGGCTGCCTGGCTCACAGGACTG
GACTGCACTCAGGGAGCTGCTGAAGCTGCTGCCACAGCCTGACCCCCAACAGATGGCCCCCATCTTTGCT
AGTAATCTAGAGCTGGCTTCGGCTTCTGCTGAGTTTGGCCCTGAGCAGCAGAAGGAACTGAACAAAGCCC
TGGAAGTCTGGAGTGTGGGCCCTCCCCTGAAGCCTCTGATGTTTGAGAAGGATGATGACAGCAACTTCCA
TGTGGACTTTGTGGTAGCGGCAGCTAGCCTGAGATGTCAGAACTACGGGATTCCACCGGTCAACCGTGCC
CAGAGCAAGCGAATTGTGGGCCAGATTATCCCAGCCATTGCCACCACTACAGCAGCTGTGGCAGGCCTGT
TGGGCCTGGAGCTGTATAAGGTGGTGAGTGGGCCACGGCCTCGTAGTGCCTTTCGCCACAGCTACCTACA
TCTGGCTGAAAACTACCTCATCCGCTATATGCCTTTTGCCCCAGCCATCCAGACGTTCCATCACCTGAAG
TGGACCTCTTGGGACCGTCTGAAGGTACCAGCTGGGCAGCCTGAGAGGACCCTGGAGTCGCTGCTGGCTC
ATCTTCAGGAGCAGCACGGGTTGAGGGTGAGGATCCTGCTGCACGGCTCAGCCCTGCTCTATGCGGCCGG
ATGGTCACCTGAAAAGCAGGCCCAGCACCTGCCCCTCAGGGTGACAGAACTGGTTCAGCAGCTGACAGGC
CAGGCACCTGCTCCTGGGCAGCGGGTGTTGGTGCTAGAGCTGAGCTGTGAGGGTGACGACGAGGACACTG
CCTTCCCACCTCTGCACTATGAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202883 protein sequence
Red=Cloning site Green=Tags(s)

MDALDASKLLDEELYSRQLYVLGSPAMQRIQGARVLVSGLQGLGAEVAKNLVLMGVGSLTLHDPHPTCWS
DLAAQFLLSEQDLERSRAEASQELLAQLNRAVQVVVHTGDITEDLLLDFQVVVLTAAKLEEQLKVGTLCH
KHGVCFLAADTRGLVGQLFCDFGEDFTVQDPTEAEPLTAAIQHISQGSPGILTLRKGANTHYFRDGDLVT
FSGIEGMVELNDCDPRSIHVREDGSLEIGDTTTFSRYLRGGAITEVKRPKTVRHKSLDTALLQPHVVAQS
SQEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETVVGLARDLEPLKRTEEEPLEEPLDEALVRTVA
LSSAGVLSPMVAMLGAVAAQEVLKAISRKFMPLDQWLYFDALDCLPEDGELLPSPEDCALRGSRYDGQIA
VFGAGFQEKLRRQHYLLVGAGAIGCELLKVFALVGLGAGNSGGLTVVDMDHIERSNLSRQFLFRSQDVGR
PKAEVAAAAARGLNPDLQVIPLTYPLDPTTEHIYGDNFFSRVDGVAAALDSFQARRYVAARCTHYLKPLL
EAGTSGTWGSATVFMPHVTEAYRAPASAAASEDAPYPVCTVRYFPSTAEHTLQWARHEFEELFRLSAETI
NHHQQAHTSLADMDEPQTLTLLKPVLGVLRVRPQNWQDCVAWALGHWKLCFHYGIKQLLRHFPPNKVLED
GTPFWSGPKQCPQPLEFDTNQDTHLLYVLAAANLYAQMHGLPGSQDWTALRELLKLLPQPDPQQMAPIFA
SNLELASASAEFGPEQQKELNKALEVWSVGPPLKPLMFEKDDDSNFHVDFVVAAASLRCQNYGIPPVNRA
QSKRIVGQIIPAIATTTAAVAGLLGLELYKVVSGPRPRSAFRHSYLHLAENYLIRYMPFAPAIQTFHHLK
WTSWDRLKVPAGQPERTLESLLAHLQEQHGLRVRILLHGSALLYAAGWSPEKQAQHLPLRVTELVQQLTG
QAPAPGQRVLVLELSCEGDDEDTAFPPLHYEL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003335
ORF Size 3036 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003335.3
RefSeq Size 3330 bp
RefSeq ORF 3039 bp
Locus ID 7318
UniProt ID P41226
Cytogenetics 3p21.31
Domains UBACT, ThiF
Protein Families Druggable Genome
Protein Pathways Parkinson's disease, Ubiquitin mediated proteolysis
MW 111.7 kDa
Gene Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme is a retinoid target that triggers promyelocytic leukemia (PML)/retinoic acid receptor alpha (RARalpha) degradation and apoptosis in acute promyelocytic leukemia, where it is involved in the conjugation of the ubiquitin-like interferon-stimulated gene 15 protein. [provided by RefSeq, Jul 2008]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.