RGS2 (NM_002923) Human Tagged ORF Clone

CAT#: RC202781

RGS2 (Myc-DDK-tagged)-Human regulator of G-protein signaling 2, 24kDa (RGS2)

Product Images

Circular map for RC202781

• 

  Western blot validation of overexpression lysate (Cat# LY401021) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC202781 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified RGS2 protein (Cat# TP302781). The protein was produced from HEK293T cells transfected with RGS2 cDNA clone (Cat# RC202781) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: RGS2
• Synonyms: G0S8
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC202781 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCAAAGTGCTATGTTCTTGGCTGTTCAACACGACTGCAGACCCATGGACAAGAGCGCAGGCAGTGGCC
  ACAAGAGCGAGGAGAAGCGAGAAAAGATGAAACGGACCCTTTTAAAAGATTGGAAGACCCGTTTGAGCTA
  CTTCTTACAAAATTCCTCTACTCCTGGGAAGCCCAAAACCGGCAAAAAAAGCAAACAGCAAGCTTTCATC
  AAGCCTTCTCCTGAGGAAGCACAGCTGTGGTCAGAAGCATTTGACGAGCTGCTAGCCAGCAAATATGGTC
  TTGCTGCATTCAGGGCTTTTTTAAAGTCGGAATTCTGTGAAGAAAATATTGAATTCTGGCTGGCCTGTGA
  AGACTTCAAAAAAACCAAATCACCCCAAAAGCTGTCCTCAAAAGCAAGGAAAATATATACTGACTTCATA
  GAAAAGGAAGCTCCAAAAGAGATAAACATAGATTTTCAAACCAAAACTCTGATTGCCCAGAATATACAAG
  AAGCTACAAGTGGCTGCTTTACAACTGCCCAGAAAAGGGTATACAGCTTGATGGAGAACAACTCTTATCC
  TCGTTTCTTGGAGTCAGAATTCTACCAGGACTTGTGTAAAAAGCCACAAATCACCACAGAGCCTCATGCT
  ACA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC202781 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFI
  KPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFI
  EKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHA
  T
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_002923
• ORF Size: 633 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_002923.4
• RefSeq Size: 1375 bp
• RefSeq ORF: 636 bp
• Locus ID: 5997
• UniProt ID: P41220
• Cytogenetics: 1q31.2
• Domains: RGS
• Protein Families: Druggable Genome
• MW: 24.4 kDa
• Gene Summary: Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 2 belongs to this family. The protein acts as a mediator of myeloid differentiation and may play a role in leukemogenesis. [provided by RefSeq, Aug 2009]