RGS2 (NM_002923) Human Tagged ORF Clone

CAT#: RC202781

Reviews ()
Write a review

RGS2 (Myc-DDK-tagged)-Human regulator of G-protein signaling 2, 24kDa (RGS2)



  "NM_002923" in other vectors (6)

Reconstitution Protocol

USD 450.00

USD 675.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "RGS2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RGS2
Synonyms G0S8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202781 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAAAGTGCTATGTTCTTGGCTGTTCAACACGACTGCAGACCCATGGACAAGAGCGCAGGCAGTGGCC
ACAAGAGCGAGGAGAAGCGAGAAAAGATGAAACGGACCCTTTTAAAAGATTGGAAGACCCGTTTGAGCTA
CTTCTTACAAAATTCCTCTACTCCTGGGAAGCCCAAAACCGGCAAAAAAAGCAAACAGCAAGCTTTCATC
AAGCCTTCTCCTGAGGAAGCACAGCTGTGGTCAGAAGCATTTGACGAGCTGCTAGCCAGCAAATATGGTC
TTGCTGCATTCAGGGCTTTTTTAAAGTCGGAATTCTGTGAAGAAAATATTGAATTCTGGCTGGCCTGTGA
AGACTTCAAAAAAACCAAATCACCCCAAAAGCTGTCCTCAAAAGCAAGGAAAATATATACTGACTTCATA
GAAAAGGAAGCTCCAAAAGAGATAAACATAGATTTTCAAACCAAAACTCTGATTGCCCAGAATATACAAG
AAGCTACAAGTGGCTGCTTTACAACTGCCCAGAAAAGGGTATACAGCTTGATGGAGAACAACTCTTATCC
TCGTTTCTTGGAGTCAGAATTCTACCAGGACTTGTGTAAAAAGCCACAAATCACCACAGAGCCTCATGCT
ACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202781 protein sequence
Red=Cloning site Green=Tags(s)

MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFI
KPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFI
EKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHA
T

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002923
ORF Size 633 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002923.4
RefSeq Size 1375 bp
RefSeq ORF 636 bp
Locus ID 5997
UniProt ID P41220
Cytogenetics 1q31.2
Domains RGS
Protein Families Druggable Genome
MW 24.4 kDa
Gene Summary Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 2 belongs to this family. The protein acts as a mediator of myeloid differentiation and may play a role in leukemogenesis. [provided by RefSeq, Aug 2009]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.