AP1M1 (NM_032493) Human Tagged ORF Clone

CAT#: RC202366

Reviews ()
Write a review

AP1M1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, mu 1 subunit (AP1M1), transcript variant 2



  "NM_032493" in other vectors (7)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name AP1M1 (NM_032493) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol AP1M1
Synonyms AP47; CLAPM2; CLTNM; MU-1A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC202366 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGCCAGCGCCGTCTACGTGCTGGACCTGAAGGGCAAGGTGCTCATCTGCCGGAACTACCGTGGCG
ACGTGGACATGTCAGAGGTGGAGCACTTCATGCCCATCCTGATGGAGAAGGAGGAGGAGGGGATGCTGTC
GCCCATCCTGGCCCACGGGGGGGTCCGTTTCATGTGGATCAAACACAACAACCTGTATCTGGTTGCCACA
TCCAAGAAGAACGCGTGCGTGTCGCTGGTCTTTTCTTTCCTCTATAAGGTGGTGCAGGTGTTTTCCGAGT
ACTTCAAGGAGCTGGAGGAGGAGAGCATCCGGGACAACTTTGTTATCATCTACGAGCTGCTGGACGAGCT
CATGGACTTCGGCTACCCCCAGACCACCGACAGCAAGATCCTGCAGGAGTACATCACTCAGGAAGGCCAC
AAGCTGGAAACAGGGGCCCCGCGGCCACCAGCCACCGTCACCAACGCGGTGTCCTGGCGGTCCGAAGGCA
TCAAGTATCGGAAGAATGAGGTGTTCTTGGACGTCATCGAGTCTGTCAACCTCTTGGTCAGCGCCAACGG
CAATGTCCTGCGCAGCGAGATCGTGGGCTCCATCAAGATGCGAGTCTTCCTCTCGGGCATGCCCGAGCTG
CGCCTGGGCCTCAACGACAAGGTCCTCTTTGACAACACGGGCCGCGGCAAAAGCAAATCCGTGGAGCTGG
AGGATGTGAAGTTCCACCAGTGTGTGCGGCTATCACGCTTCGAGAATGACCGCACCATCTCCTTCATCCC
ACCCGACGGCGAGTTCGAGCTCATGTCCTACCGTCTCAACACCCACGTCAAGCCTTTGATATGGATCGAG
TCGGTGATCGAGAAGCACTCCCACAGCCGCATCGAGTACATGATCAAGGCCAAAAGCCAGTTCAAGCGGC
GGTCAACAGCCAACAACGTGGAGATCCACATTCCCGTGCCCAATGATGCCGACTCACCCAAGTTCAAGAC
GACGGTGGGGAGCGTTAAGTGGGTCCCCGAGAACAGCGAGATTGTGTGGTCCATCAAGTCCTTCCCGGGC
GGCAAGGAGTACCTGATGCGGGCCCACTTCGGCCTGCCTAGTGTGGAGGCCGAAGACAAGGAGGGCAAGC
CCCCGATCAGTGTCAAGTTCGAGATCCCTTACTTCACTACCTCCGGCATCCAGGTGCGCTACCTGAAGAT
CATTGAGAAGAGTGGGTACCAGGCCCTGCCCTGGGTGCGTTATATCACGCAGAATGGAGATTACCAGCTC
CGGACCCAG


ACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGA
TTACAAGGATGACGACGATAAG
GTTTAA
>RC202366 protein sequence
Red=Cloning site Green=Tags(s)

MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVAT
SKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGH
KLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPEL
RLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIE
SVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPG
GKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQL
RTQ

TRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-NotI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_032493
ORF Size 1269 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_032493.1, NM_032493.2, NM_032493.3, NP_115882.1
RefSeq Size 2373 bp
RefSeq ORF 1272 bp
Locus ID 8907
Cytogenetics 19p13.11
Domains Adap_comp_sub
Protein Pathways Lysosome
MW 48.6 kDa
Gene Summary The protein encoded by this gene is the medium chain of the trans-Golgi network clathrin-associated protein complex AP-1. The other components of this complex are beta-prime-adaptin, gamma-adaptin, and the small chain AP1S1. This complex is located at the Golgi vesicle and links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Citations (2)

Other Versions

Other products for "AP1M1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit polyclonal AP1M1 Antibody (Center)
    • 400 ul

USD 450.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools