USP13 (NM_003940) Human Tagged ORF Clone

CAT#: RC202190

Reviews ()
Write a review

USP13 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 13 (isopeptidase T-3) (USP13)



Reconstitution Protocol

USD 790.00

In Stock*

Size
    • 10 ug

Product images

Other products for "USP13"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol USP13
Synonyms IsoT-3; ISOT3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202190 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCGCCGGGGCGCCCTGTTCGGCATGCCGGGCGGCAGCGGAGGCAGGAAGATGGCTGCAGGAGACA
TCGGCGAGCTGCTAGTGCCCCACATGCCCACGATCCGCGTGCCCAGGTCCGGCGACAGGGTCTACAAGAA
CGAGTGCGCCTTCTCCTACGACTCTCCCAATTCTGAAGGTGGACTCTATGTATGCATGAATACATTTTTG
GCCTTTGGAAGGGAACATGTTGAAAGACATTTTCGAAAAACTGGACAGAGTGTATACATGCACCTGAAAA
GACATGTGCGAGAGAAGGTAAGAGGGGCGTCTGGTGGAGCGTTACCAAAAAGGAGGAATTCCAAGATTTT
TTTAGATCTAGATACTGATGACGATTTAAATAGCGACGATTATGAATATGAAGATGAAGCCAAACTTGTT
ATATTCCCAGATCACTATGAAATAGCACTACCAAATATTGAGGAGTTACCAGCCCTGGTAACAATTGCTT
GTGATGCAGTTCTCAGCTCAAAATCTCCATACAGAAAGCAGGACCCAGACACGTGGGAAAATGAATTGCC
AGTATCTAAATATGCCAACAACCTCACCCAGCTGGACAATGGAGTCAGGATTCCTCCAAGTGGTTGGAAG
TGTGCCAGATGCGACCTGCGAGAAAACCTCTGGTTGAATCTGACTGACGGCTCTGTCCTGTGTGGAAAGT
GGTTCTTTGACAGCTCTGGGGGCAACGGGCATGCGCTGGAGCATTACAGAGACATGGGCTACCCACTAGC
CGTGAAACTGGGAACCATCACTCCTGACGGGGCAGATGTTTATTCTTTTCAAGAAGAAGAACCTGTTTTG
GATCCTCATTTGGCCAAGCACTTAGCGCATTTTGGAATTGATATGCTTCATATGCATGGGACAGAGAATG
GGCTCCAGGACAATGACATCAAGCTGAGGGTCAGTGAGTGGGAAGTGATCCAGGAGTCGGGCACGAAACT
GAAGCCAATGTATGGTCCTGGCTACACGGGTCTGAAGAACCTGGGCAACAGCTGCTATCTCAGCTCTGTC
ATGCAGGCCATCTTCAGCATCCCAGAATTCCAGAGAGCGTATGTAGGAAACCTTCCCAGAATATTTGACT
ACTCGCCTTTAGATCCAACACAAGATTTCAACACACAGATGACTAAGTTAGGACATGGCCTTCTCTCAGG
CCAGTATTCAAAGCCTCCGGTGAAATCTGAACTCATTGAACAGGTGATGAAGGAGGAGCACAAGCCACAG
CAGAACGGGATCTCTCCGCGCATGTTTAAGGCCTTTGTAAGCAAGAGCCACCCGGAATTCTCCTCTAACA
GGCAGCAAGATGCCCAGGAATTCTTCTTGCACCTGGTGAATCTAGTAGAGAGGAACCGCATCGGCTCAGA
AAACCCAAGCGATGTTTTTCGTTTTTTGGTGGAAGAACGCATTCAGTGCTGTCAGACCCGGAAAGTCCGC
TACACGGAGAGGGTGGATTACCTGATGCAGTTACCTGTGGCCATGGAGGCGGCAACCAACAAGGATGAAC
TGATCGCTTATGAACTAACGAGAAGGGAAGCAGAAGCAAACAGAAGACCCCTTCCTGAGTTGGTACGTGC
CAAGATACCATTTAGTGCCTGCCTTCAGGCCTTCTCTGAACCAGAAAATGTTGATGATTTCTGGAGCAGT
GCCCTACAAGCAAAGTCTGCGGGTGTGAAAACATCTCGCTTTGCTTCATTCCCTGAATACTTGGTAGTGC
AGATAAAGAAGTTCACTTTTGGTCTTGACTGGGTTCCCAAAAAATTTGATGTTTCTATTGATATGCCAGA
CCTACTTGATATCAACCATCTCCGAGCCAGGGGGTTACAGCCAGGAGAGGAAGAACTTCCAGACATCAGC
CCCCCCATAGTCATTCCTGATGACTCAAAAGATCGCCTGATGAACCAATTGATAGACCCATCAGACATCG
ATGAGTCATCAGTGATGCAGCTGGCCGAGATGGGTTTCCCGCTGGAAGCATGTCGCAAGGCTGTGTACTT
CACTGGAAATATGGGCGCCGAGGTGGCCTTCAACTGGATCATTGTTCACATGGAAGAGCCAGATTTTGCT
GAGCCGCTGACCATGCCTGGTTATGGAGGGGCAGCTTCTGCTGGAGCCTCTGTTTTTGGTGCTTCTGGAC
TGGATAACCAACCTCCAGAGGAAATCGTAGCTATCATCACCTCCATGGGATTTCAGCGAAATCAGGCTAT
TCAGGCACTACGAGCAACGAATAATAACCTGGAAAGAGCACTGGATTGGATCTTTAGCCACCCTGAGTTT
GAAGAAGACAGTGATTTTGTGATTGAGATGGAGAATAATGCCAATGCAAACATTATTTCTGAGGCCAAGC
CCGAAGGACCTAGAGTCAAGGATGGATCTGGAACATATGAGCTATTTGCATTCATCAGTCACATGGGAAC
ATCCACAATGAGTGGTCATTACATTTGCCATATCAAAAAGGAAGGAAGATGGGTGATTTACAATGACCAC
AAAGTTTGTGCCTCAGAAAGGCCCCCTAAAGACCTGGGCTACATGTACTTTTACCGCAGGATACCAAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202190 protein sequence
Red=Cloning site Green=Tags(s)

MQRRGALFGMPGGSGGRKMAAGDIGELLVPHMPTIRVPRSGDRVYKNECAFSYDSPNSEGGLYVCMNTFL
AFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDDLNSDDYEYEDEAKLV
IFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDNGVRIPPSGWK
CARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVL
DPHLAKHLAHFGIDMLHMHGTENGLQDNDIKLRVSEWEVIQESGTKLKPMYGPGYTGLKNLGNSCYLSSV
MQAIFSIPEFQRAYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKPQ
QNGISPRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEERIQCCQTRKVR
YTERVDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPELVRAKIPFSACLQAFSEPENVDDFWSS
ALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFDVSIDMPDLLDINHLRARGLQPGEEELPDIS
PPIVIPDDSKDRLMNQLIDPSDIDESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFA
EPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEF
EEDSDFVIEMENNANANIISEAKPEGPRVKDGSGTYELFAFISHMGTSTMSGHYICHIKKEGRWVIYNDH
KVCASERPPKDLGYMYFYRRIPS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003940
ORF Size 2589 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003940.3
RefSeq Size 7933 bp
RefSeq ORF 2592 bp
Locus ID 8975
UniProt ID Q92995
Cytogenetics 3q26.33
Domains UBA, UCH, zf-UBP
Protein Families Druggable Genome, Protease
MW 97.3 kDa
Gene Summary Deubiquitinase that mediates deubiquitination of target proteins such as BECN1, MITF, SKP2 and USP10 and is involved in various processes such as autophagy and endoplasmic reticulum-associated degradation (ERAD). Component of a regulatory loop that controls autophagy and p53/TP53 levels: mediates deubiquitination of BECN1, a key regulator of autophagy, leading to stabilize the PIK3C3/VPS34-containing complexes. Also deubiquitinates USP10, an essential regulator of p53/TP53 stability. In turn, PIK3C3/VPS34-containing complexes regulate USP13 stability, suggesting the existence of a regulatory system by which PIK3C3/VPS34-containing complexes regulate p53/TP53 protein levels via USP10 and USP13. Recruited by nuclear UFD1 and mediates deubiquitination of SKP2, thereby regulating endoplasmic reticulum-associated degradation (ERAD). Also regulates ERAD through the deubiquitination of UBL4A a component of the BAG6/BAT3 complex. Mediates stabilization of SIAH2 independently of deubiquitinase activity: binds ubiquitinated SIAH2 and acts by impairing SIAH2 autoubiquitination. Has a weak deubiquitinase activity in vitro and preferentially cleaves 'Lys-63'-linked polyubiquitin chains. In contrast to USP5, it is not able to mediate unanchored polyubiquitin disassembly. Able to cleave ISG15 in vitro; however, additional experiments are required to confirm such data.[UniProtKB/Swiss-Prot Function]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.