IKB beta (NFKBIB) (NM_002503) Human Tagged ORF Clone

CAT#: RC202182

Reviews ()
Write a review

NFKBIB (Myc-DDK-tagged)-Human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta (NFKBIB), transcript variant 1



  "NM_002503" in other vectors (7)

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NFKBIB
Synonyms IKBB; TRIP9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202182 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGGGGTCGCGTGCTTGGGAAAAGCTGCCGACGCAGATGAATGGTGCGACAGCGGCCTGGGCTCCC
TGGGTCCGGACGCAGCGGCCCCCGGAGGACCTGGGTTGGGCGCGGAGTTGGGCCCGGGGCTGTCGTGGGC
TCCCCTCGTCTTCGGCTACGTCACTGAGGATGGGGACACGGCACTGCACTTGGCTGTGATTCATCAGCAT
GAACCCTTCCTGGATTTTCTTCTAGGCTTCTCGGCCGGCACTGAGTACATGGACCTGCAGAATGACCTAG
GCCAGACAGCCCTGCACCTGGCAGCCATCCTGGGGGAGACATCCACGGTGGAGAAGCTGTACGCAGCAGG
CGCCGGGCTGTGTGTGGCGGAGCGTAGGGGCCACACGGCGCTGCACCTGGCCTGCCGTGTGGGGGCACAC
GCCTGTGCCCGTGCCCTGCTTCAGCCCCGCCCCCGGCGCCCCAGGGAAGCCCCCGACACCTACCTCGCTC
AGGGCCCTGACCGTACTCCCGACACCAACCATACCCCTGTCGCCTTGTACCCCGATTCCGACTTGGAGAA
GGAAGAAGAGGAGAGTGAGGAGGACTGGAAGCTGCAGCTGGAGGCTGAAAACTACGAGGGCCACACCCCA
CTCCACGTGGCCGTTATCCACAAAGATGTGGAGATGGTCCGGCTGCTCCGAGATGCTGGAGCTGACCTTG
ACAAACCGGAGCCCACGTGCGGCCGGAGCCCCCTTCATTTGGCAGTGGAGGCCCAGGCAGCCGATGTGCT
GGAGCTTCTCCTGAGGGCAGGCGCGAACCCTGCTGCCCGCATGTACGGTGGCCGCACCCCACTCGGCAGT
GCCATGCTCCGGCCCAACCCCATCCTCGCCCGCCTCCTCCGTGCACACGGAGCCCCTGAGCCCGAGGGCG
AGGACGAGAAATCCGGCCCCTGCAGCAGCAGTAGCGACAGCGACAGCGGAGACGAGGGCGATGAATACGA
CGACATTGTGGTTCACAGCAGCCGCAGCCAAACCCGGCTGCCTCCCACCCCAGCCTCAAAACCTCTTCCT
GACGACCCCCGCCCCGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202182 protein sequence
Red=Cloning site Green=Tags(s)

MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDTALHLAVIHQH
EPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAH
ACARALLQPRPRRPREAPDTYLAQGPDRTPDTNHTPVALYPDSDLEKEEEESEEDWKLQLEAENYEGHTP
LHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPLGS
AMLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRSQTRLPPTPASKPLP
DDPRPV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002503
ORF Size 1068 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002503.5
RefSeq Size 1243 bp
RefSeq ORF 1071 bp
Locus ID 4793
UniProt ID Q15653
Cytogenetics 19q13.2
Domains ANK
Protein Families Stem cell - Pluripotency, Transcription Factors
Protein Pathways Adipocytokine signaling pathway, B cell receptor signaling pathway, Chemokine signaling pathway, Cytosolic DNA-sensing pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway
MW 37.8 kDa
Gene Summary The protein encoded by this gene belongs to the NF-kappa-B inhibitor family, which inhibit NF-kappa-B by complexing with, and trapping it in the cytoplasm. Phosphorylation of serine residues on these proteins by kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B, which translocates to the nucleus to function as a transcription factor. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Jul 2011]

Other Versions

Other products for "NFKBIB"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit anti-NFKBIB Polyclonal Antibody
    • 100 ul

USD 275.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.