NCKAP1 (NM_013436) Human Tagged ORF Clone

CAT#: RC201960

Reviews ()
Write a review

NCKAP1 (Myc-DDK-tagged)-Human NCK-associated protein 1 (NCKAP1), transcript variant 1



Reconstitution Protocol

USD 982.00

USD 1,473.00

In Stock*

Size
    • 10 ug

Product images

Other products for "NCKAP1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NCKAP1
Synonyms HEM2; NAP1; NAP125; p125Nap1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201960 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCGCTCAGTGCTGCAGCCCAGTCAGCAGAAGCTGGCGGAGAAGCTCACCATCCTCAACGACCGGG
GCGTCGGCATGCTCACCCGCCTCTACAACATCAAGAAGGCATGTGGAGACCCCAAGGCAAAACCATCCTA
TCTTATCGACAAAAACCTGGAATCTGCTGTGAAATTCATAGTCAGAAAATTCCCTGCTGTAGAAACCCGC
AACAACAATCAACAGCTTGCACAACTACAGAAAGAAAAATCAGAGATTCTGAAAAATCTGGCATTATATT
ACTTCACATTTGTAGATGTTATGGAATTTAAGGACCATGTTTGTGAATTGCTGAATACTATTGACGTTTG
CCAAGTCTTCTTTGATATTACTGTAAACTTTGATTTAACAAAGAACTACTTAGATTTAATTATAACCTAT
ACAACACTAATGATACTGCTGTCTCGAATTGAAGAAAGGAAGGCAATCATTGGATTATACAACTATGCCC
ATGAAATGACTCATGGAGCAAGTGACAGAGAATACCCACGCCTTGGCCAGATGATTGTGGATTATGAAAA
CCCTTTAAAGAAGATGATGGAAGAATTTGTACCCCATAGCAAGTCTCTTTCAGATGCACTAATTTCTCTT
CAAATGGTATATCCTCGAAGGAATCTTTCAGCTGACCAGTGGAGAAATGCCCAGTTATTGAGCCTCATCA
GTGCACCTAGTACAATGCTTAATCCAGCACAGTCCGACACTATGCCTTGTGAATACCTCTCTTTGGATGC
AATGGAAAAGTGGATTATCTTTGGCTTTATTTTGTGCCATGGGATCCTAAATACTGACGCTACAGCACTG
AACCTTTGGAAACTAGCTCTTCAAAGTAGCTCTTGCCTCTCTCTCTTTCGGGATGAAGTTTTCCACATTC
ACAAAGCTGCAGAAGACTTATTTGTAAACATACGAGGCTATAATAAACGTATTAATGACATAAGAGAATG
CAAGGAGGCAGCCGTGTCACATGCTGGTTCAATGCACAGAGAAAGACGCAAGTTTTTAAGATCTGCACTG
AAGGAATTGGCTACTGTCCTCTCTGATCAACCTGGATTGCTAGGTCCCAAGGCACTTTTTGTTTTTATGG
CATTATCCTTTGCCCGTGATGAAATCATCTGGCTACTTCGTCATGCAGATAACATGCCAAAGAAGAGTGC
AGACGACTTTATAGATAAGCACATTGCTGAATTAATATTTTACATGGAAGAACTTAGAGCACATGTGAGG
AAATACGGACCTGTAATGCAGAGGTATTACGTGCAGTACCTTTCTGGCTTTGATGCTGTTGTCCTCAATG
AACTCGTGCAGAATCTTTCTGTTTGCCCTGAAGATGAATCAATCATCATGTCCTCTTTTGTTAACACTAT
GACTTCCCTAAGTGTAAAACAAGTTGAAGATGGGGAAGTATTTGATTTCAGAGGAATGAGATTAGATTGG
TTTAGGTTACAGGCATATACTAGTGTCTCAAAGGCTTCACTTGGCCTTGCAGATCACAGAGAACTTGGAA
AGATGATGAATACAATAATTTTTCATACAAAAATGGTAGATTCCTTGGTGGAAATGTTGGTGGAAACATC
AGATCTCTCCATATTTTGTTTTTATAGTCGTGCTTTTGAGAAGATGTTTCAACAGTGTTTGGAGTTACCC
TCTCAATCAAGATACTCAATTGCATTTCCACTACTTTGCACTCATTTTATGAGTTGCACGCATGAACTAT
GTCCAGAAGAGCGACATCATATTGGAGATCGCAGTCTTTCCTTATGTAATATGTTCCTAGATGAAATGGC
CAAACAAGCTCGAAATCTCATCACTGATATTTGCACAGAACAGTGTACCCTTAGTGACCAGTTGCTACCC
AAGCATTGTGCCAAAACTATCAGTCAAGCAGTGAATAAGAAATCAAAAAAGCAGACTGGTAAGAAAGGGG
AACCTGAAAGGGAGAAACCAGGTGTTGAGAGCATGAGGAAAAACAGGCTGGTTGTGACCAACCTTGATAA
ATTGCACACTGCACTTTCTGAGTTATGCTTCTCTATAAATTATGTACCAAACATGGTGGTATGGGAACAT
ACCTTTACCCCACGAGAATATTTGACTTCTCATCTGGAAATACGCTTTACCAAGTCAATTGTTGGGATGA
CTATGTATAATCAAGCCACACAGGAAATTGCAAAACCTTCAGAACTTCTAACAAGTGTAAGAGCATACAT
GACCGTACTCCAGTCAATAGAAAACTATGTGCAGATTGATATTACAAGAGTATTTAATAATGTGCTTCTT
CAACAAACACAACATTTAGACAGTCATGGAGAGCCAACCATTACAAGTCTATACACAAATTGGTATTTGG
AAACTTTGTTACGACAAGTCAGCAATGGCCATATAGCATATTTTCCTGCAATGAAAGCGTTTGTGAACTT
ACCTACAGAAAATGAATTAACATTCAATGCAGAGGAATATTCTGACATATCAGAAATGAGGTCATTATCA
GAACTACTAGGCCCATATGGTATGAAGTTTCTAAGTGAAAGCCTTATGTGGCATATTTCATCACAAGTTG
CTGAACTTAAGAAACTTGTGGTGGAGAATGTTGATGTGTTAACACAAATGAGGACCAGCTTTGACAAACC
AGACCAGATGGCTGCACTGTTTAAAAGATTATCATCTGTTGACAGTGTCTTGAAGAGGATGACAATAATT
GGTGTAATTTTATCCTTCCGATCATTGGCACAAGAAGCACTTAGAGATGTCTTATCCTACCACATTCCTT
TTCTTGTAAGTTCAATTGAAGATTTTAAGGATCACATTCCAAGGGAAACTGATATGAAGGTTGCAATGAA
TGTGTATGAGTTATCATCAGCTGCCGGATTACCTTGTGAGATTGATCCTGCATTGGTCGTAGCTCTTTCT
TCACAAAAATCGGAAAACATTAGTCCAGAAGAAGAGTATAAAATTGCCTGCCTTCTCATGGTGTTTGTGG
CAGTTTCTTTGCCAACACTGGCCAGTAATGTGATGTCTCAGTACAGCCCTGCTATAGAAGGGCATTGCAA
CAACATACATTGCTTGGCCAAAGCCATCAACCAGATTGCTGCAGCTTTGTTTACAATTCACAAAGGAAGC
ATTGAAGACCGTCTTAAAGAATTTCTGGCGCTTGCATCCTCCAGTCTACTGAAAATTGGCCAGGAGACAG
ATAAAACTACAACAAGAAATAGAGAATCTGTTTATTTACTGCTAGATATGATTGTACAAGAATCTCCATT
CCTTACAATGGATCTTTTGGAATCTTGTTTTCCTTATGTCTTGCTGAGAAATGCATACCATGCTGTCTAC
AAACAAAGTGTTACATCTTCTGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201960 protein sequence
Red=Cloning site Green=Tags(s)

MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETR
NNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITY
TTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISL
QMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPCEYLSLDAMEKWIIFGFILCHGILNTDATAL
NLWKLALQSSSCLSLFRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSAL
KELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNMPKKSADDFIDKHIAELIFYMEELRAHVR
KYGPVMQRYYVQYLSGFDAVVLNELVQNLSVCPEDESIIMSSFVNTMTSLSVKQVEDGEVFDFRGMRLDW
FRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELP
SQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLP
KHCAKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMVVWEH
TFTPREYLTSHLEIRFTKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLL
QQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENELTFNAEEYSDISEMRSLS
ELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSVDSVLKRMTII
GVILSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPALVVALS
SQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIHKGS
IEDRLKEFLALASSSLLKIGQETDKTTTRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVY
KQSVTSSA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_013436
ORF Size 3384 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_013436.5
RefSeq Size 4997 bp
RefSeq ORF 3387 bp
Locus ID 10787
UniProt ID Q9Y2A7
Cytogenetics 2q32.1
Protein Families Druggable Genome
Protein Pathways Regulation of actin cytoskeleton
MW 128.8 kDa
Gene Summary Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Actin remodeling activity is regulated by RAC1. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes.[UniProtKB/Swiss-Prot Function]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.