ALAD (NM_000031) Human Tagged ORF Clone

CAT#: RC201545

ALAD (Myc-DDK-tagged)-Human aminolevulinate dehydratase (ALAD)

Clone Modification / Custom Cloning Service

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ALAD (NM_000031) Human Tagged ORF Clone
Symbol ALAD
Synonyms ALADH; PBGS
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201545 representing NM_000031
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCCTGTGCCCACTGGCCCACGCCATGCAGCCCCAGTCCGTTCTGCACAGCGGCTACTTCCACCCAC
TACTTCGGGCCTGGCAGACAGCCACCACCACCCTCAATGCCTCCAACCTCATCTACCCCATCTTTGTCAC
GGATGTTCCTGATGACATACAGCCTATCACCAGCCTCCCAGGAGTGGCCAGGTACGGTGTGAAGCGGCTG
GAAGAGATGCTGAGGCCCTTGGTGGAAGAGGGCCTACGCTGTGTCTTGATCTTTGGCGTCCCCAGCAGAG
TTCCCAAGGACGAGCGGGGTTCCGCAGCTGACTCCGAGGAGTCCCCAGCTATTGAGGCAATCCATCTGTT
GAGGAAGACCTTCCCCAACCTCCTGGTGGCCTGTGATGTCTGCCTGTGTCCCTACACCTCCCATGGTCAC
TGCGGGCTCCTGAGTGAAAACGGAGCATTCCGGGCTGAGGAGAGCCGCCAGCGGCTGGCTGAGGTGGCAT
TGGCGTATGCCAAGGCAGGATGTCAGGTGGTAGCCCCGTCGGACATGATGGATGGACGCGTGGAAGCCAT
CAAAGAGGCCCTGATGGCACATGGACTTGGCAACAGGGTATCGGTGATGAGCTACAGTGCCAAATTTGCT
TCCTGTTTCTATGGCCCTTTCCGGGATGCAGCTAAGTCAAGCCCAGCTTTTGGGGACCGCCGCTGCTACC
AGCTGCCCCCTGGAGCACGAGGCCTGGCTCTCCGAGCTGTGGACCGGGATGTACGGGAAGGAGCTGACAT
GCTCATGGTGAAGCCGGGAATGCCCTACCTGGACATCGTGCGGGAGGTAAAGGACAAGCACCCTGACCTC
CCTCTCGCCGTGTACCACGTCTCTGGAGAGTTTGCCATGCTGTGGCATGGAGCCCAGGCCGGGGCATTTG
ATCTCAAGGCTGCCGTACTGGAGGCCATGACTGCCTTCCGCAGAGCAGGTGCTGACATCATCATCACCTA
CTACACACCGCAGCTGCTGCAGTGGCTGAAGGAGGAA


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201545 representing NM_000031
Red=Cloning site Green=Tags(s)

MPLCPLAHAMQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKRL
EEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGH
CGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFA
SCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDL
PLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000031
ORF Size 1017 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000031.2, NM_000031.3, NM_000031.4, NP_000022
RefSeq Size 3151
RefSeq ORF 993
Locus ID 210
Cytogenetics 9q32
Domains ALAD
Protein Families Druggable Genome
Protein Pathways Porphyrin and chlorophyll metabolism, Metabolic pathways
MW 37.23 kDa
Gene Summary The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)