ARF5 (NM_001662) Human Tagged ORF Clone

CAT#: RC201363

ARF5 (Myc-DDK-tagged)-Human ADP-ribosylation factor 5 (ARF5)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ARF5 (NM_001662) Human Tagged ORF Clone
Symbol ARF5
Synonyms ADP-ribosylation factor 5
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201363 representing NM_001662
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCTCACCGTGTCCGCGCTCTTTTCGCGGATCTTCGGGAAGAAGCAGATGCGGATTCTCATGGTTG
GCTTGGATGCGGCTGGCAAGACCACAATCCTGTACAAACTGAAGTTGGGGGAGATTGTCACCACCATCCC
AACCATAGGCTTCAATGTAGAAACAGTGGAATATAAGAACATCTGTTTCACAGTCTGGGACGTGGGAGGC
CAGGACAAGATTCGGCCTCTGTGGCGGCACTACTTCCAGAACACTCAGGGCCTCATCTTTGTGGTGGACA
GTAATGACCGGGAGCGGGTCCAAGAATCTGCTGATGAACTCCAGAAGATGCTGCAGGAGGACGAGCTGCG
GGATGCAGTGCTGCTGGTATTTGCCAACAAGCAGGACATGCCCAACGCCATGCCCGTGAGCGAGCTGACT
GACAAGCTGGGGCTACAGCACTTACGCAGCCGCACGTGGTATGTCCAGGCCACCTGTGCCACCCAAGGCA
CAGGTCTGTACGATGGTCTGGACTGGCTGTCCCACGAGCTGTCAAAGCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201363 representing NM_001662
Red=Cloning site Green=Tags(s)

MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG
QDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELT
DKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001662
ORF Size 540 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001662.1, NM_001662.2, NM_001662.3, NP_001653
RefSeq Size 978
RefSeq ORF 543
Locus ID 381
Cytogenetics 7q32.1
Domains RAB, SAR, ARF, arf
MW 20.3 kDa
Gene Summary GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)