DCP1A (NM_018403) Human Tagged ORF Clone

CAT#: RC201330

Reviews ()
Write a review

DCP1A (Myc-DDK-tagged)-Human DCP1 decapping enzyme homolog A (S. cerevisiae) (DCP1A)



  "NM_018403" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 542.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "DCP1A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DCP1A
Synonyms HSA275986; Nbla00360; SMAD4IP1; SMIF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201330 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCGCTGAGTCGAGCTGGGCAGGAGATGAGCCTAGCGGCCCTGAAGCAACACGACCCCTATATCA
CCAGCATCGCAGACCTCACGGGCCAGGTCGCTCTGTACACCTTCTGCCCCAAGGCCAACCAGTGGGAGAA
GACTGATATAGAAGGGACCTTATTCGTATATCGAAGGTCAGCTTCCCCTTACCATGGTTTTACCATTGTG
AATCGACTAAATATGCACAATCTAGTTGAACCAGTGAATAAAGATTTGGAATTTCAGCTCCATGAACCAT
TTCTTCTGTATAGAAATGCAAGCTTGTCGATATATAGTATCTGGTTTTATGACAAGAATGACTGTCACCG
CATAGCAAAACTCATGGCTGATGTGGTAGAAGAGGAGACACGGCGATCCCAGCAAGCTGCTCGGGACAAA
CAGAGTCCCAGCCAGGCCAATGGCTGCAGCGACCACAGGCCCATCGACATCCTGGAGATGCTGAGCAGAG
CCAAGGATGAGTATGAGAGGAATCAGATGGGTGACTCAAATATCTCCAGCCCTGGGTTACAGCCAAGCAC
TCAGCTCTCCAATCTGGGAAGCACCGAGACTCTAGAAGAAATGCCCTCCGGGTCACAGGATAAGTCTGCT
CCATCTGGACACAAGCATCTGACGGTAGAAGAGTTATTTGGAACCTCTTTGCCAAAGGAACAACCAGCAG
TTGTGGGTCTGGATTCAGAAGAAATGGAGAGGTTGCCAGGAGATGCCTCCCAGAAAGAGCCCAATTCATT
CCTACCATTTCCCTTTGAGCAGTTAGGAGGAGCCCCTCAATCAGAAACCCTGGGTGTCCCTTCTGCTGCC
CACCATTCAGTCCAGCCTGAAATCACCACCCCGGTGCTAATCACTCCAGCCTCCATCACACAGTCCAATG
AAAAGCATGCTCCAACCTACACAATCCCGTTGAGCCCTGTTCTCAGTCCCACTCTGCCAGCTGAAGCTCC
TACTGCACAGGTTCCCCCCAGCTTACCTCGAAACAGCACCATGATGCAGGCAGTGAAGACCACGCCTAGA
CAGAGGTCTCCACTCCTGAACCAGCCAGTCCCTGAGCTAAGCCATGCCAGTCTGATTGCCAACCAGAGCC
CCTTCAGGGCCCCATTGAACGTGACGAACACAGCTGGCACATCCCTCCCAAGCGTTGATCTTCTCCAGAA
ACTCAGGTTGACCCCACAGCATGACCAAATACAGACACAACCACTTGGGAAAGGTGCAATGGTAGCCAGC
TTTTCTCCGGCAGCTGGTCAGCTAGCCACACCTGAGAGCTTCATAGAGCCTCCCTCTAAGACAGCAGCAG
CAAGAGTGGCGGCCTCAGCCTCCCTGAGCAACATGGTGCTTGCTCCCCTTCAGTCTATGCAGCAGAACCA
GGATCCTGAAGTATTTGTGCAGCCTAAGGTGTTATCCAGTGCCATCCCGGTTGCAGGCGCCCCACTGGTT
ACTGCAACGACCACTGCAGTGTCTTCAGTCCTGCTGGCCCCAAGTGTTTTCCAGCAGACAGTTACAAGAT
CTTCGGACCTTGAGAGGAAAGCCAGCTCCCCTTCTCCTCTAACTATTGGAACGCCAGAAAGTCAGAGAAA
GCCTTCCATTATTCTCAGCAAGTCTCAGCTCCAGGATACATTAATACATCTAATAAAGAATGATTCCAGC
TTCCTCAGTACACTTCATGAAGTCTACTTGCAGGTTCTGACCAAGAACAAAGACAACCACAACCTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201330 protein sequence
Red=Cloning site Green=Tags(s)

MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIV
NRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDK
QSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSA
PSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAA
HHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPR
QRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVAS
FSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLV
TATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSS
FLSTLHEVYLQVLTKNKDNHNL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_018403
ORF Size 1746 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_018403.7
RefSeq Size 6027 bp
RefSeq ORF 1749 bp
Locus ID 55802
UniProt ID Q9NPI6
Cytogenetics 3p21.1
Protein Families Transcription Factors
Protein Pathways RNA degradation
MW 63.3 kDa
Gene Summary Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.