DCP1A (NM_018403) Human Tagged ORF Clone

CAT#: RC201330

DCP1A (Myc-DDK-tagged)-Human DCP1 decapping enzyme homolog A (S. cerevisiae) (DCP1A)

Need custom modification / cloning service?
Get a free quote

USD 742.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name DCP1A (NM_018403) Human Tagged ORF Clone
Symbol DCP1A
Synonyms HSA275986; Nbla00360; SMAD4IP1; SMIF
Vector pCMV6-Entry
Sequence Data
>RC201330 representing NM_018403
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCGCTGAGTCGAGCTGGGCAGGAGATGAGCCTAGCGGCCCTGAAGCAACACGACCCCTATATCA
CCAGCATCGCAGACCTCACGGGCCAGGTCGCTCTGTACACCTTCTGCCCCAAGGCCAACCAGTGGGAGAA
GACTGATATAGAAGGGACCTTATTCGTATATCGAAGGTCAGCTTCCCCTTACCATGGTTTTACCATTGTG
AATCGACTAAATATGCACAATCTAGTTGAACCAGTGAATAAAGATTTGGAATTTCAGCTCCATGAACCAT
TTCTTCTGTATAGAAATGCAAGCTTGTCGATATATAGTATCTGGTTTTATGACAAGAATGACTGTCACCG
CATAGCAAAACTCATGGCTGATGTGGTAGAAGAGGAGACACGGCGATCCCAGCAAGCTGCTCGGGACAAA
CAGAGTCCCAGCCAGGCCAATGGCTGCAGCGACCACAGGCCCATCGACATCCTGGAGATGCTGAGCAGAG
CCAAGGATGAGTATGAGAGGAATCAGATGGGTGACTCAAATATCTCCAGCCCTGGGTTACAGCCAAGCAC
TCAGCTCTCCAATCTGGGAAGCACCGAGACTCTAGAAGAAATGCCCTCCGGGTCACAGGATAAGTCTGCT
CCATCTGGACACAAGCATCTGACGGTAGAAGAGTTATTTGGAACCTCTTTGCCAAAGGAACAACCAGCAG
TTGTGGGTCTGGATTCAGAAGAAATGGAGAGGTTGCCAGGAGATGCCTCCCAGAAAGAGCCCAATTCATT
CCTACCATTTCCCTTTGAGCAGTTAGGAGGAGCCCCTCAATCAGAAACCCTGGGTGTCCCTTCTGCTGCC
CACCATTCAGTCCAGCCTGAAATCACCACCCCGGTGCTAATCACTCCAGCCTCCATCACACAGTCCAATG
AAAAGCATGCTCCAACCTACACAATCCCGTTGAGCCCTGTTCTCAGTCCCACTCTGCCAGCTGAAGCTCC
TACTGCACAGGTTCCCCCCAGCTTACCTCGAAACAGCACCATGATGCAGGCAGTGAAGACCACGCCTAGA
CAGAGGTCTCCACTCCTGAACCAGCCAGTCCCTGAGCTAAGCCATGCCAGTCTGATTGCCAACCAGAGCC
CCTTCAGGGCCCCATTGAACGTGACGAACACAGCTGGCACATCCCTCCCAAGCGTTGATCTTCTCCAGAA
ACTCAGGTTGACCCCACAGCATGACCAAATACAGACACAACCACTTGGGAAAGGTGCAATGGTAGCCAGC
TTTTCTCCGGCAGCTGGTCAGCTAGCCACACCTGAGAGCTTCATAGAGCCTCCCTCTAAGACAGCAGCAG
CAAGAGTGGCGGCCTCAGCCTCCCTGAGCAACATGGTGCTTGCTCCCCTTCAGTCTATGCAGCAGAACCA
GGATCCTGAAGTATTTGTGCAGCCTAAGGTGTTATCCAGTGCCATCCCGGTTGCAGGCGCCCCACTGGTT
ACTGCAACGACCACTGCAGTGTCTTCAGTCCTGCTGGCCCCAAGTGTTTTCCAGCAGACAGTTACAAGAT
CTTCGGACCTTGAGAGGAAAGCCAGCTCCCCTTCTCCTCTAACTATTGGAACGCCAGAAAGTCAGAGAAA
GCCTTCCATTATTCTCAGCAAGTCTCAGCTCCAGGATACATTAATACATCTAATAAAGAATGATTCCAGC
TTCCTCAGTACACTTCATGAAGTCTACTTGCAGGTTCTGACCAAGAACAAAGACAACCACAACCTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201330 representing NM_018403
Red=Cloning site Green=Tags(s)

MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIV
NRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDK
QSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSA
PSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAA
HHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPR
QRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVAS
FSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLV
TATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSS
FLSTLHEVYLQVLTKNKDNHNL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_018403
ORF Size 1746 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_018403.1, NM_018403.3, NM_018403.4, NM_018403.5, NM_018403.6, NP_060873
RefSeq Size 2054
RefSeq ORF 1749
Locus ID 55802
Cytogenetics 3p21.1
Protein Families Transcription Factors
Protein Pathways RNA degradation
MW 63.1 kDa
Gene Summary Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)