Neurogranin (NRGN) (NM_006176) Human Tagged ORF Clone
CAT#: RC201209
NRGN (Myc-DDK-tagged)-Human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_006176" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Neurogranin |
Synonyms | hng; RC3 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC201209 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACTGCTGCACCGAGAACGCCTGCTCCAAGCCGGACGACGACATTCTAGACATCCCGCTGGACGATC CCGGCGCCAACGCGGCCGCCGCCAAAATCCAGGCGAGTTTTCGGGGCCACATGGCGCGGAAGAAGATAAA GAGCGGAGAGCGCGGCCGGAAGGGCCCGGGCCCTGGGGGGCCTGGCGGAGCTGGGGTGGCCCGGGGAGGC GCGGGCGGCGGCCCCAGCGGAGAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC201209 protein sequence
Red=Cloning site Green=Tags(s) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGG AGGGPSGD myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_006176 |
ORF Size | 234 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_006176.3 |
RefSeq Size | 1235 bp |
RefSeq ORF | 237 bp |
Locus ID | 4900 |
UniProt ID | Q92686 |
Cytogenetics | 11q24.2 |
Domains | IQ |
Protein Families | Druggable Genome |
MW | 7.6 kDa |
Gene Summary | Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC201209L1 | Lenti ORF clone of Human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1, Myc-DDK-tagged |
USD 450.00 |
|
RC201209L2 | Lenti ORF clone of Human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1, mGFP tagged |
USD 450.00 |
|
RC201209L3 | Lenti ORF clone of Human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1, Myc-DDK-tagged |
USD 450.00 |
|
RC201209L4 | Lenti ORF clone of Human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1, mGFP tagged |
USD 450.00 |
|
RG201209 | NRGN (tGFP-tagged) - Human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1 |
USD 350.00 |
|
SC116291 | NRGN (untagged)-Human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1 |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review