RRP4 (EXOSC2) (NM_014285) Human Tagged ORF Clone

CAT#: RC200753

Reviews ()
Write a review

EXOSC2 (Myc-DDK-tagged)-Human exosome component 2 (EXOSC2)



  "NM_014285" in other vectors (4)

USD 98.00

USD 470.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name RRP4 (EXOSC2) (NM_014285) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol EXOSC2
Synonyms hRrp4p; p7; RRP4; Rrp4p; SHRF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200753 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGATGGAGATGAGGCTTCCAGTGGCTCGCAAGCCTCTTAGCGAGAGACTGGGCCGCGACACTAAGA
AACATCTAGTGGTGCCGGGGGATACAATCACTACGGACACAGGATTCATGCGGGGCCATGGAACGTATAT
GGGAGAAGAGAAGCTCATTGCATCTGTTGCTGGCTCTGTGGAGAGAGTAAACAAGTTGATCTGTGTGAAA
GCTTTGAAAACCAGATACATTGGTGAAGTAGGAGACATCGTAGTGGGACGAATCACAGAGGTTCAACAGA
AGAGGTGGAAGGTGGAGACCAACTCCAGGCTGGATTCGGTCTTGCTGCTCTCGTCCATGAACCTTCCTGG
AGGAGAGCTGAGGAGAAGATCTGCAGAAGATGAGCTTGCAATGAGAGGTTTCTTACAGGAAGGGGACCTT
ATCAGTGCTGAGGTCCAGGCAGTGTTCTCTGACGGAGCTGTCTCTTTGCACACGAGGAGCCTGAAATATG
GAAAACTAGGTCAGGGGGTTTTGGTCCAGGTTTCCCCCTCCCTGGTGAAACGGCAGAAGACCCACTTTCA
TGATTTGCCATGTGGTGCCTCAGTGATTCTCGGTAACAACGGCTTCATCTGGATTTACCCAACACCTGAG
CACAAAGAAGAGGAAGCAGGGGGCTTCATTGCAAACCTGGAGCCTGTCTCTCTTGCTGATCGAGAGGTGA
TATCCCGGCTTCGGAACTGCATCATCTCGCTGGTAACTCAGAGGATGATGCTGTATGATACCAGCATCCT
GTACTGCTATGAAGCATCCCTTCCACATCAGATCAAAGACATCTTAAAGCCAGAAATAATGGAGGAGATT
GTGATGGAAACACGCCAGAGGCTTTTGGAACAGGAGGGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200753 protein sequence
Red=Cloning site Green=Tags(s)

MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVK
ALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDL
ISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPE
HKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEI
VMETRQRLLEQEG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014285
ORF Size 879 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014285.7
RefSeq Size 2034 bp
RefSeq ORF 882 bp
Locus ID 23404
Cytogenetics 9q34.12
Protein Pathways RNA degradation
MW 32.8 kDa
Gene Summary Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC2 as peripheral part of the Exo-9 complex stabilizes the hexameric ring of RNase PH-domain subunits through contacts with EXOSC4 and EXOSC7.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "EXOSC2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 350.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-EXOSC2 Antibody
    • 100 ul

USD 360.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools