EXT1 (NM_000127) Human Tagged ORF Clone

CAT#: RC200644

EXT1 (Myc-DDK-tagged)-Human exostosin 1 (EXT1)

Change vector?

USD 98

USD 560


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name EXT1 (NM_000127) Human Tagged ORF Clone
Symbol EXT1
Synonyms EXT; LGCR; LGS; TRPS2; TTV
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200644 representing NM_000127
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGCCAAAAAACGCTATTTCATCCTGCTCTCAGCTGGCTCTTGTCTCGCCCTTTTGTTTTATTTCG
GAGGCTTGCAGTTTAGGGCATCGAGGAGCCACAGCCGGAGAGAAGAACACAGCGGTAGGAATGGCTTGCA
CCACCCCAGTCCGGATCATTTCTGGCCCCGCTTCCCGGACGCTCTGCGCCCCTTCGTTCCTTGGGATCAA
TTGGAAAACGAGGATTCCAGCGTGCACATTTCCCCCCGGCAGAAGCGAGATGCCAACTCCAGCATCTACA
AAGGCAAGAAGTGCCGCATGGAGTCCTGCTTCGATTTCACCCTTTGCAAGAAAAACGGCTTCAAAGTCTA
CGTATACCCACAGCAAAAAGGGGAGAAAATCGCCGAAAGTTACCAAAACATTCTAGCGGCCATCGAGGGC
TCCAGGTTCTACACCTCGGACCCCAGCCAGGCGTGCCTCTTTGTCCTGAGTCTGGATACTTTAGACAGAG
ACCAGTTGTCACCTCAGTATGTGCACAATTTGAGATCCAAAGTGCAGAGTCTCCACTTGTGGAACAATGG
TAGGAATCATTTAATTTTTAATTTATATTCCGGCACTTGGCCTGACTACACCGAGGACGTGGGGTTTGAC
ATCGGCCAGGCGATGCTGGCCAAAGCCAGCATCAGTACTGAAAACTTCCGACCCAACTTTGATGTTTCTA
TTCCCCTCTTTTCTAAGGATCATCCCAGGACAGGAGGGGAGAGGGGGTTTTTGAAGTTCAACACCATCCC
TCCTCTCAGGAAGTACATGCTGGTATTCAAGGGGAAGAGGTACCTGACAGGGATAGGATCAGACACCAGG
AATGCCTTATATCACGTCCATAACGGGGAGGACGTTGTGCTCCTCACCACCTGCAAGCATGGCAAAGACT
GGCAAAAGCACAAGGATTCTCGCTGTGACAGAGACAACACCGAGTATGAGAAGTATGATTATCGGGAAAT
GCTGCACAATGCCACTTTCTGTCTGGTTCCTCGTGGTCGCAGGCTTGGGTCCTTCAGATTCCTGGAGGCT
TTGCAGGCTGCCTGCGTCCCTGTGATGCTCAGCAATGGATGGGAGTTGCCATTCTCTGAAGTGATTAATT
GGAACCAAGCTGCCGTCATAGGCGATGAGAGATTGTTATTACAGATTCCTTCTACAATCAGGTCTATTCA
TCAGGATAAAATCCTAGCACTTAGACAGCAGACACAATTCTTGTGGGAGGCTTATTTTTCTTCAGTTGAG
AAGATTGTATTAACTACACTAGAGATTATTCAGGACAGAATATTCAAGCACATATCACGTAACAGTTTAA
TATGGAACAAACATCCTGGAGGATTGTTCGTACTACCACAGTATTCATCTTATCTGGGAGATTTTCCTTA
CTACTATGCTAATTTAGGTTTAAAGCCCCCCTCCAAATTCACTGCAGTCATCCATGCGGTGACCCCCCTG
GTCTCTCAGTCCCAGCCAGTGTTGAAGCTTCTCGTGGCTGCAGCCAAGTCCCAGTACTGTGCCCAGATCA
TAGTTCTATGGAATTGTGACAAGCCCCTACCAGCCAAACACCGCTGGCCTGCCACTGCTGTGCCTGTCGT
CGTCATTGAAGGAGAGAGCAAGGTTATGAGCAGCCGTTTTCTGCCCTACGACAACATCATCACAGACGCC
GTGCTCAGCCTTGACGAGGACACGGTGCTTTCAACAACAGAGGTGGATTTCGCCTTCACAGTGTGGCAGA
GCTTCCCTGAGAGGATTGTGGGGTACCCCGCGCGCAGCCACTTCTGGGATAACTCTAAGGAGCGGTGGGG
ATACACATCAAAGTGGACGAACGACTACTCCATGGTGTTGACAGGAGCTGCTATTTACCACAAATATTAT
CACTACCTATACTCCCATTACCTGCCAGCCAGCCTGAAGAACATGGTGGACCAATTGGCCAATTGTGAGG
ACATTCTCATGAACTTCCTGGTGTCTGCTGTGACAAAATTGCCTCCAATCAAAGTGACCCAGAAGAAGCA
GTATAAGGAGACAATGATGGGACAGACTTCTCGGGCTTCCCGTTGGGCTGACCCTGACCACTTTGCCCAG
CGACAGAGCTGCATGAATACGTTTGCCAGCTGGTTTGGCTACATGCCGCTGATCCACTCTCAGATGAGGC
TCGACCCCGTCCTCTTTAAAGACCAGGTCTCTATTTTGAGGAAGAAATACCGAGACATTGAGCGACTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200644 representing NM_000127
Red=Cloning site Green=Tags(s)

MQAKKRYFILLSAGSCLALLFYFGGLQFRASRSHSRREEHSGRNGLHHPSPDHFWPRFPDALRPFVPWDQ
LENEDSSVHISPRQKRDANSSIYKGKKCRMESCFDFTLCKKNGFKVYVYPQQKGEKIAESYQNILAAIEG
SRFYTSDPSQACLFVLSLDTLDRDQLSPQYVHNLRSKVQSLHLWNNGRNHLIFNLYSGTWPDYTEDVGFD
IGQAMLAKASISTENFRPNFDVSIPLFSKDHPRTGGERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTR
NALYHVHNGEDVVLLTTCKHGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCLVPRGRRLGSFRFLEA
LQAACVPVMLSNGWELPFSEVINWNQAAVIGDERLLLQIPSTIRSIHQDKILALRQQTQFLWEAYFSSVE
KIVLTTLEIIQDRIFKHISRNSLIWNKHPGGLFVLPQYSSYLGDFPYYYANLGLKPPSKFTAVIHAVTPL
VSQSQPVLKLLVAAAKSQYCAQIIVLWNCDKPLPAKHRWPATAVPVVVIEGESKVMSSRFLPYDNIITDA
VLSLDEDTVLSTTEVDFAFTVWQSFPERIVGYPARSHFWDNSKERWGYTSKWTNDYSMVLTGAAIYHKYY
HYLYSHYLPASLKNMVDQLANCEDILMNFLVSAVTKLPPIKVTQKKQYKETMMGQTSRASRWADPDHFAQ
RQSCMNTFASWFGYMPLIHSQMRLDPVLFKDQVSILRKKYRDIERL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000127
ORF Size 2238 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000127.1, NM_000127.2, NP_000118
RefSeq Size 3376
RefSeq ORF 2241
Locus ID 2131
Cytogenetics 8q24.11
Domains Exostosin
Protein Families Transmembrane, Druggable Genome
Protein Pathways Heparan sulfate biosynthesis, Metabolic pathways
MW 86.1 kDa
Gene Summary This gene encodes an endoplasmic reticulum-resident type II transmembrane glycosyltransferase involved in the chain elongation step of heparan sulfate biosynthesis. Mutations in this gene cause the type I form of multiple exostoses. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations