NCBP1 (NM_002486) Human Tagged ORF Clone

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name NCBP1 (NM_002486) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NCBP1
Synonyms CBP80; NCBP; Sto1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200630 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCGGCGGCGGCACAGCGACGAGAACGACGGTGGGCAGCCTCACAAAAGGAGAAAGACCTCTGATG
CAAATGAAACTGAAGATCATTTGGAATCTTTAATATGTAAAGTAGGAGAAAAGAGTGCCTGCTCTTTGGA
GAGCAACCTAGAAGGCTTGGCTGGTGTTTTGGAAGCTGATCTTCCTAACTACAAGAGCAAGATCTTAAGG
CTTCTTTGTACAGTTGCACGCCTATTACCTGAGAAGCTGACAATTTATACAACATTAGTTGGACTACTGA
ATGCCAGGAATTACAATTTTGGTGGAGAATTTGTAGAAGCCATGATTCGTCAACTTAAAGAATCATTGAA
AGCAAACAATTATAATGAAGCCGTGTATTTGGTCCGTTTTTTATCTGATCTTGTGAATTGTCATGTGATT
GCCGCCCCATCAATGGTTGCTATGTTTGAAAATTTTGTAAGCGTAACTCAGGAAGAAGATGTACCTCAGG
TGCGACGAGATTGGTATGTGTATGCATTTCTGTCATCTTTGCCCTGGGTTGGAAAGGAGTTGTACGAAAA
GAAAGATGCAGAGATGGACCGCATCTTTGCCAACACTGAAAGCTATCTTAAAAGACGCCAAAAGACTCAT
GTACCCATGTTACAGGTATGGACTGCTGATAAACCACATCCACAAGAAGAGTATTTAGATTGCCTGTGGG
CCCAGATTCAGAAATTGAAAAAGGATCGCTGGCAGGAACGGCACATCCTAAGACCTTATCTTGCCTTTGA
CAGCATCCTGTGTGAAGCACTGCAGCACAATCTGCCTCCTTTTACACCACCTCCTCACACTGAAGATTCA
GTGTACCCAATGCCAAGGGTCATCTTCAGAATGTTTGATTACACAGATGATCCCGAGGGTCCTGTCATGC
CAGGGAGTCATTCAGTGGAAAGATTTGTAATAGAAGAGAATCTTCACTGCATCATTAAGTCCCACTGGAA
GGAAAGGAAGACTTGTGCTGCACAGTTAGTGAGCTATCCAGGGAAGAACAAGATCCCCTTGAACTACCAC
ATAGTTGAGGTGATCTTTGCAGAGCTGTTTCAACTTCCAGCACCCCCTCACATTGATGTGATGTACACAA
CACTCCTCATTGAACTGTGCAAACTTCAACCTGGCTCTCTACCCCAAGTTCTTGCACAGGCAACTGAAAT
GCTATACATGCGTTTGGACACAATGAACACTACCTGTGTAGACAGGTTTATTAATTGGTTTTCTCATCAT
CTAAGTAACTTCCAGTTCCGTTGGAGCTGGGAAGATTGGTCAGATTGTCTTAGTCAAGATCCTGAAAGTC
CCAAACCGAAGTTTGTAAGAGAAGTTCTAGAAAAATGTATGAGGTTGTCTTACCATCAGCGTATATTAGA
TATTGTTCCTCCTACCTTCTCAGCTCTGTGTCCTGCAAACCCAACCTGCATTTACAAGTATGGAGATGAA
AGTAGCAATTCTCTTCCTGGACATTCTGTTGCCCTCTGTTTAGCTGTTGCCTTTAAAAGTAAGGCAACCA
ATGATGAAATCTTCAGCATTCTGAAAGATGTACCAAATCCTAACCAGGATGATGACGACGATGAAGGATT
CAGTTTTAACCCATTGAAAATAGAAGTCTTTGTACAGACTCTGCTACACTTGGCAGCCAAATCATTCAGC
CACTCCTTCAGTGCTCTTGCAAAGTTTCATGAAGTCTTCAAAACCCTAGCTGAAAGTGATGAAGGAAAGT
TACATGTGCTAAGAGTTATGTTTGAGGTCTGGAGGAACCATCCACAGATGATTGCTGTACTAGTGGATAA
GATGATTCGTACACAAATAGTTGATTGTGCTGCCGTAGCAAATTGGATCTTCTCTTCAGAACTATCTCGT
GACTTTACCAGATTGTTTGTTTGGGAAATTTTGCACTCTACAATTCGTAAGATGAACAAACATGTCCTGA
AGATCCAGAAAGAGCTGGAAGAAGCTAAAGAGAAACTTGCTAGGCAACACAAACGGCGAAGTGATGATGA
CGACAGAAGCAGTGACAGGAAAGACGGGGTTCTTGAGGAACAAATAGAACGACTTCAGGAAAAAGTGGAA
TCTGCTCAGAGTGAACAAAAGAATCTTTTCCTCGTTATATTTCAGCGGTTTATCATGATCTTGACCGAGC
ACCTAGTACGATGCGAAACTGATGGGACCAGTGTATTAACACCATGGTATAAGAACTGTATAGAGAGGCT
GCAGCAGATCTTCCTACAGCATCACCAAATAATCCAGCAGTACATGGTGACCCTGGAGAACCTTCTCTTC
ACTGCTGAATTAGACCCTCATATCTTGGCCGTGTTCCAGCAGTTCTGTGCCCTGCAGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200630 protein sequence
Red=Cloning site Green=Tags(s)

MSRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILR
LLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVI
AAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFANTESYLKRRQKTH
VPMLQVWTADKPHPQEEYLDCLWAQIQKLKKDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDS
VYPMPRVIFRMFDYTDDPEGPVMPGSHSVERFVIEENLHCIIKSHWKERKTCAAQLVSYPGKNKIPLNYH
IVEVIFAELFQLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHH
LSNFQFRWSWEDWSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSALCPANPTCIYKYGDE
SSNSLPGHSVALCLAVAFKSKATNDEIFSILKDVPNPNQDDDDDEGFSFNPLKIEVFVQTLLHLAAKSFS
HSFSALAKFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSSELSR
DFTRLFVWEILHSTIRKMNKHVLKIQKELEEAKEKLARQHKRRSDDDDRSSDRKDGVLEEQIERLQEKVE
SAQSEQKNLFLVIFQRFIMILTEHLVRCETDGTSVLTPWYKNCIERLQQIFLQHHQIIQQYMVTLENLLF
TAELDPHILAVFQQFCALQA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_002486
ORF Size 2370 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002486.1, NM_002486.2, NM_002486.3, NM_002486.4, NP_002477.1
RefSeq Size 5381
RefSeq ORF 2373
Locus ID 4686
Cytogenetics 9q22.33
Domains MIF4G
Protein Pathways Spliceosome
MW 91.8 kDa
Gene Summary The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein promotes high-affinity mRNA-cap binding and associates with the CTD of RNA polymerase II. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "NCBP1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit polyclonal anti-NCBP1 antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools