SART1 (NM_005146) Human Tagged ORF Clone

CAT#: RC200603

Reviews ()
Write a review

SART1 (Myc-DDK-tagged)-Human squamous cell carcinoma antigen recognized by T cells (SART1)



  "NM_005146" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 616.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SART1
Synonyms Ara1; HAF; HOMS1; SART1259; SNRNP110; Snu66
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200603 representing NM_005146
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGTCGTCCAAGAAGCATCGCGGAGAGAAGGAGGCGGCCGGGACGACGGCGGCGGCCGGCACCGGGG
GTGCCACCGAGCAGCCGCCGCGGCACCGGGAACACAAAAAACACAAGCACCGGAGTGGCGGCAGTGGCGG
TAGCGGTGGCGAACGACGGAAGCGGAGCCGGGAACGTGGGGGCGAGCGCGGGAGCGGGCGGCGCGGGGCC
GAAGCTGAGGCCCGGAGCAGCACGCACGGGCGGGAGCGCAGCCAGGCAGAGCCCTCCGAGCGGCGCGTGA
AGCGGGAGAAGCGCGATGACGGCTACGAGGCCGCTGCCAGCTCCAAAACTAGCTCAGGCGATGCCTCCTC
ACTCAGCATCGAGGAGACTAACAAACTCCGGGCAAAGTTGGGGCTGAAACCCTTGGAGGTTAATGCCATC
AAGAAGGAGGCGGGCACCAAGGAGGAGCCCGTGACAGCTGATGTCATCAACCCTATGGCCTTGCGACAGC
GAGAGGAGCTGCGGGAGAAGCTGGCGGCTGCCAAGGAGAAGCGCCTGCTGAACCAAAAGCTGGGGAAGAT
AAAGACCCTAGGAGAGGATGACCCCTGGCTGGACGACACTGCAGCCTGGATCGAGAGGAGCCGGCAGCTG
CAGAAGGAGAAGGACCTGGCAGAGAAGAGGGCCAAGTTACTGGAGGAGATGGACCAAGAGTTTGGTGTCA
GCACTCTGGTGGAGGAGGAGTTCGGGCAGAGGCGGCAGGACCTGTACAGTGCCCGGGACCTGCAGGGCCT
CACCGTGGAGCATGCCATTGATTCCTTCCGAGAAGGGGAGACAATGATTCTTACCCTCAAGGACAAAGGC
GTGCTGCAGGAGGAGGAGGACGTGCTGGTGAACGTGAACCTGGTGGATAAGGAGCGGGCAGAGAAAAATG
TGGAGCTGCGGAAGAAGAAGCCTGACTACCTGCCCTATGCCGAGGACGAGAGCGTGGACGACCTGGCGCA
GCAAAAACCTCGCTCTATCCTGTCCAAGTATGACGAAGAGCTTGAAGGGGAGCGGCCACATTCCTTCCGC
TTGGAGCAGGGCGGCACGGCTGATGGCCTGCGGGAGCGGGAGCTGGAGGAGATCCGGGCCAAGCTGCGGC
TGCAGGCTCAGTCCCTGAGCACAGTGGGGCCCCGGCTGGCCTCCGAATACCTCACGCCTGAGGAGATGGT
GACCTTTAAAAAGACCAAGCGGAGGGTGAAGAAAATCCGCAAGAAGGAGAAGGAGGTAGTAGTGCGGGCA
GATGACTTGCTGCCTCTCGGGGACCAGACTCAGGATGGGGACTTTGGTTCCAGACTGCGGGGACGGGGTC
GCCGCCGAGTGTCCGAAGTGGAGGAGGAGAAGGAGCCTGTGCCTCAGCCCCTGCCGTCGGACGACACCCG
AGTGGAGAACATGGACATCAGTGATGAGGAGGAAGGTGGAGCTCCACCGCCGGGGTCCCCGCAGGTGCTG
GAGGAGGACGAGGCGGAGCTGGAGCTGCAGAAGCAGCTGGAGAAGGGACGCCGGCTGCGACAGTTACAGC
AGCTACAGCAGCTGCGAGACAGTGGCGAGAAGGTGGTGGAGATTGTGAAGAAGCTGGAGTCTCGCCAGCG
GGGCTGGGAGGAGGATGAGGATCCCGAGCGGAAGGGGGCCATCGTGTTCAACGCCACGTCCGAGTTCTGC
CGCACCTTGGGGGAGATCCCCACCTACGGGCTGGCTGGCAATCGCGAGGAGCAGGAGGAGCTCATGGACT
TTGAACGGGATGAGGAGCGCTCAGCCAACGGTGGCTCCGAATCTGACGGGGAGGAGAACATCGGCTGGAG
CACGGTGAACCTGGACGAGGAGAAGCAGCAGCAGGATTTCTCTGCTTCCTCCACCACCATCCTGGACGAG
GAACCGATCGTGAATAGGGGGCTGGCAGCTGCCCTGCTCCTGTGTCAGAACAAAGGGCTGCTGGAGACCA
CAGTGCAGAAGGTGGCCCGGGTGAAGGCCCCCAACAAGTCGCTGCCCTCAGCCGTGTACTGCATCGAGGA
TAAGATGGCCATCGATGACAAGTACAGCCGGAGGGAGGAATACCGAGGCTTCACACAGGACTTCAAGGAG
AAGGACGGCTACAAACCCGACGTTAAGATCGAATACGTGGATGAGACGGGCCGGAAACTCACACCCAAGG
AGGCTTTCCGGCAGCTGTCGCACCGCTTCCATGGCAAGGGCTCAGGCAAGATGAAGACAGAGCGGCGGAT
GAAGAAGCTGGACGAGGAGGCGCTCCTGAAGAAGATGAGCTCCAGCGACACGCCCCTGGGCACCGTGGCC
CTGCTCCAGGAGAAGCAGAAGGCTCAGAAGACCCCCTACATCGTGCTCAGCGGCAGCGGCAAGAGCATGA
ACGCGAACACCATCACCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200603 representing NM_005146
Red=Cloning site Green=Tags(s)

MGSSKKHRGEKEAAGTTAAAGTGGATEQPPRHREHKKHKHRSGGSGGSGGERRKRSRERGGERGSGRRGA
EAEARSSTHGRERSQAEPSERRVKREKRDDGYEAAASSKTSSGDASSLSIEETNKLRAKLGLKPLEVNAI
KKEAGTKEEPVTADVINPMALRQREELREKLAAAKEKRLLNQKLGKIKTLGEDDPWLDDTAAWIERSRQL
QKEKDLAEKRAKLLEEMDQEFGVSTLVEEEFGQRRQDLYSARDLQGLTVEHAIDSFREGETMILTLKDKG
VLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGERPHSFR
LEQGGTADGLRERELEEIRAKLRLQAQSLSTVGPRLASEYLTPEEMVTFKKTKRRVKKIRKKEKEVVVRA
DDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGGAPPPGSPQVL
EEDEAELELQKQLEKGRRLRQLQQLQQLRDSGEKVVEIVKKLESRQRGWEEDEDPERKGAIVFNATSEFC
RTLGEIPTYGLAGNREEQEELMDFERDEERSANGGSESDGEENIGWSTVNLDEEKQQQDFSASSTTILDE
EPIVNRGLAAALLLCQNKGLLETTVQKVARVKAPNKSLPSAVYCIEDKMAIDDKYSRREEYRGFTQDFKE
KDGYKPDVKIEYVDETGRKLTPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKMSSSDTPLGTVA
LLQEKQKAQKTPYIVLSGSGKSMNANTITK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005146
ORF Size 2400 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005146.5
RefSeq Size 3601 bp
RefSeq ORF 2403 bp
Locus ID 9092
UniProt ID O43290
Cytogenetics 11q13.1
Domains SART-1
Protein Pathways Spliceosome
MW 90.7 kDa
Gene Summary This gene encodes two proteins, the SART1(800) protein expressed in the nucleus of the majority of proliferating cells, and the SART1(259) protein expressed in the cytosol of epithelial cancers. The SART1(259) protein is translated by the mechanism of -1 frameshifting during posttranscriptional regulation; its full-length sequence is not published yet. The two encoded proteins are thought to be involved in the regulation of proliferation. Both proteins have tumor-rejection antigens. The SART1(259) protein possesses tumor epitopes capable of inducing HLA-A2402-restricted cytotoxic T lymphocytes in cancer patients. This SART1(259) antigen may be useful in specific immunotherapy for cancer patients and may serve as a paradigmatic tool for the diagnosis and treatment of patients with atopy. The SART1(259) protein is found to be essential for the recruitment of the tri-snRNP to the pre-spliceosome in the spliceosome assembly pathway. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "SART1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal antibody to SART1 (squamous cell carcinoma antigen recognized by T cells)
    • 100 ul

USD 473.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.