KDM4A (NM_014663) Human Tagged ORF Clone

CAT#: RC200574

Reviews ()
Write a review

KDM4A (Myc-DDK-tagged)-Human lysine (K)-specific demethylase 4A (KDM4A)



  "NM_014663" in other vectors (6)

Reconstitution Protocol

USD 926.00

USD 1,389.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "KDM4A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KDM4A
Synonyms JHDM3A; JMJD2; JMJD2A; TDRD14A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200574 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCTGAGTCTGAAACTCTGAATCCCAGTGCTAGGATAATGACCTTTTATCCAACTATGGAAGAGT
TCCGAAACTTCAGTAGATACATTGCCTACATTGAATCCCAAGGAGCTCATCGGGCAGGGCTAGCCAAGGT
TGTTCCTCCAAAAGAGTGGAAGCCACGAGCATCCTATGATGACATTGATGATTTGGTCATTCCTGCCCCC
ATTCAACAGCTGGTGACGGGGCAGTCTGGCCTCTTTACTCAGTACAACATACAGAAGAAAGCCATGACTG
TTCGAGAGTTCCGCAAGATAGCCAATAGCGATAAGTACTGTACCCCACGCTATAGTGAGTTTGAAGAGCT
CGAGCGGAAATACTGGAAAAATCTTACATTCAATCCTCCAATCTATGGTGCAGATGTGAATGGTACCCTC
TATGAAAAGCATGTTGATGAGTGGAATATTGGCCGGCTGAGAACAATCCTGGACTTGGTGGAAAAGGAGA
GTGGGATCACCATTGAGGGTGTGAACACCCCATACCTGTACTTTGGCATGTGGAAGACATCCTTTGCTTG
GCACACTGAAGACATGGACCTCTACAGCATCAACTACCTGCACTTTGGAGAACCAAAGTCCTGGTACTCT
GTTCCACCTGAGCATGGAAAGCGGTTGGAACGCCTCGCCAAAGGCTTTTTCCCAGGAAGTGCTCAAAGCT
GTGAGGCATTTCTCCGCCACAAGATGACCCTGATTTCCCCGTTAATGCTGAAGAAATATGGAATTCCCTT
TGACAAGGTGACTCAAGAGGCTGGAGAGTTTATGATCACTTTCCCTTATGGTTACCATGCCGGCTTTAAC
CATGGTTTTAACTGTGCGGAGTCTACCAATTTTGCTACCCGTCGGTGGATTGAGTACGGCAAGCAAGCTG
TGCTGTGCTCCTGTAGAAAGGACATGGTGAAGATCTCCATGGATGTGTTTGTGAGAAAGTTCCAGCCAGA
AAGGTACAAACTTTGGAAAGCTGGGAAGGACAACACAGTTATTGACCATACTCTGCCCACGCCAGAAGCA
GCTGAGTTTCTTAAGGAGAGTGAACTGCCTCCAAGAGCTGGCAACGAGGAGGAGTGCCCAGAGGAGGACA
TGGAAGGGGTGGAGGATGGAGAGGAAGGAGACCTGAAGACAAGCCTGGCCAAGCACCGAATAGGGACAAA
GAGGCACCGAGTTTGTCTTGAAATACCACAGGAGGTGAGTCAGAGTGAGCTCTTCCCCAAGGAGGATCTG
AGTTCTGAGCAGTATGAGATGACGGAGTGCCCGGCAGCCCTCGCCCCTGTGAGGCCCACCCATAGCTCTG
TGCGGCAAGTTGAGGATGGTCTTACCTTCCCAGATTATTCTGACTCCACTGAAGTCAAATTTGAAGAGCT
TAAAAATGTCAAACTAGAAGAGGAGGATGAGGAGGAAGAACAAGAAGCAGCTGCCTTGGATCTTTCTGTG
AATCCTGCGTCTGTAGGGGGACGCCTTGTCTTCTCAGGCTCCAAAAAGAAATCATCTTCTAGCCTGGGCT
CTGGCTCTTCACGGGATTCTATCTCTTCTGATTCAGAAACTAGTGAGCCTCTCTCCTGCCGAGCCCAAGG
GCAAACGGGAGTTCTCACTGTGCACAGTTATGCCAAAGGGGATGGCAGGGTCACTGTGGGAGAGCCATGC
ACGAGGAAGAAAGGAAGCGCCGCTAGAAGTTTCAGTGAGCGGGAGCTGGCAGAGGTTGCAGATGAATACA
TGTTTTCCCTAGAAGAGAATAAGAAGTCCAAGGGACGCCGTCAGCCTTTAAGCAAGCTCCCCCGCCATCA
CCCACTTGTGCTGCAGGAGTGTGTCAGTGATGATGAGACATCTGAACAGCTGACCCCTGAGGAAGAGGCT
GAGGAGACAGAGGCCTGGGCCAAGCCTCTGAGCCAACTGTGGCAGAACCGACCTCCAAACTTTGAGGCTG
AGAAGGAATTCAATGAGACCATGGCCCAACAGGCCCCTCACTGCGCTGTCTGTATGATCTTCCAGACTTA
TCATCAGGTTGAATTTGGAGGCTTTAATCAGAACTGTGGAAATGCTTCAGATTTAGCCCCCCAGAAGCAG
AGGACCAAGCCATTGATTCCAGAAATGTGCTTCACTTCGACTGGCTGCAGCACGGACATCAACCTTTCTA
CTCCTTATCTTGAGGAGGATGGCACCAGCATACTCGTTTCCTGCAAGAAGTGCAGCGTCCGGGTCCATGC
CAGTTGCTATGGGGTCCCCCCTGCAAAGGCTTCTGAAGACTGGATGTGTTCTCGGTGTTCAGCCAATGCC
CTAGAGGAGGACTGCTGTTTATGCTCATTACGAGGAGGGGCCCTGCAGAGAGCAAATGATGACAGGTGGG
TCCACGTTTCATGTGCTGTGGCAATTCTGGAAGCAAGGTTTGTCAACATTGCAGAAAGAAGTCCGGTGGA
TGTGAGCAAAATCCCCCTGCCCCGCTTCAAACTGAAATGTATCTTCTGTAAGAAGCGGAGGAAAAGAACT
GCTGGCTGCTGTGTGCAGTGTTCTCACGGCCGCTGCCCAACTGCCTTCCATGTGAGCTGCGCCCAGGCTG
CCGGTGTGATGATGCAGCCTGACGACTGGCCTTTTGTGGTCTTCATTACCTGCTTTCGGCACAAGATTCC
TAATTTGGAGCGTGCCAAGGGGGCCTTGCAAAGCATCACTGCAGGCCAGAAAGTCATTAGCAAGCATAAG
AACGGGCGCTTCTACCAGTGTGAAGTGGTCAGGCTCACCACCGAGACCTTCTATGAAGTCAACTTTGATG
ATGGCTCCTTCAGCGACAATCTTTATCCTGAGGACATAGTGAGCCAGGACTGTCTCCAGTTTGGTCCTCC
TGCTGAAGGGGAAGTGGTCCAAGTGAGATGGACAGACGGCCAAGTCTATGGAGCCAAGTTTGTGGCCTCC
CACCCTATCCAAATGTACCAGGTGGAGTTTGAGGATGGCTCACAACTTGTGGTTAAGAGAGATGATGTAT
ACACACTGGATGAAGAGCTTCCCAAGAGAGTCAAATCTAGACTGTCAGTAGCCTCAGACATGCGCTTCAA
TGAGATTTTCACAGAGAAAGAGGTTAAGCAAGAAAAGAAACGGCAACGAGTTATCAACTCAAGATACCGG
GAAGATTATATTGAGCCTGCACTATACCGGGCCATCATGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200574 protein sequence
Red=Cloning site Green=Tags(s)

MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAP
IQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTL
YEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYS
VPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFN
HGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEA
AEFLKESELPPRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDL
SSEQYEMTECPAALAPVRPTHSSVRQVEDGLTFPDYSDSTEVKFEELKNVKLEEEDEEEEQEAAALDLSV
NPASVGGRLVFSGSKKKSSSSLGSGSSRDSISSDSETSEPLSCRAQGQTGVLTVHSYAKGDGRVTVGEPC
TRKKGSAARSFSERELAEVADEYMFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEA
EETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQ
RTKPLIPEMCFTSTGCSTDINLSTPYLEEDGTSILVSCKKCSVRVHASCYGVPPAKASEDWMCSRCSANA
LEEDCCLCSLRGGALQRANDDRWVHVSCAVAILEARFVNIAERSPVDVSKIPLPRFKLKCIFCKKRRKRT
AGCCVQCSHGRCPTAFHVSCAQAAGVMMQPDDWPFVVFITCFRHKIPNLERAKGALQSITAGQKVISKHK
NGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVAS
HPIQMYQVEFEDGSQLVVKRDDVYTLDEELPKRVKSRLSVASDMRFNEIFTEKEVKQEKKRQRVINSRYR
EDYIEPALYRAIME

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014663
ORF Size 3192 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014663.1, NP_055478.1
RefSeq Size 4526 bp
RefSeq ORF 3195 bp
Locus ID 9682
UniProt ID O75164
Cytogenetics 1p34.2-p34.1
Domains PHD, TUDOR, JmjC, JmjN
Protein Families Druggable Genome, Transcription Factors
MW 120.7 kDa
Gene Summary This gene is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein containing a JmjN domain, a JmjC domain, a JD2H domain, two TUDOR domains, and two PHD-type zinc fingers. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form, and as a transcriptional repressor. [provided by RefSeq, Apr 2009]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.