Acidic Calponin (CNN3) (NM_001839) Human Tagged ORF Clone

CAT#: RC200488

Reviews ()
Write a review

CNN3 (Myc-DDK-tagged)-Human calponin 3, acidic (CNN3)



Reconstitution Protocol

USD 300.00

USD 450.00

In Stock*

Size
    • 10 ug

Product images

Other products for "CNN3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CNN3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200488 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCCACTTCAACAAGGGCCCTTCCTATGGGCTCTCGGCCGAAGTCAAGAACAAGATTGCTTCCAAGT
ATGATCATCAGGCAGAAGAAGATCTTCGCAATTGGATAGAAGAGGTGACAGGCATGAGCATTGGCCCCAA
CTTCCAGCTGGGCTTAAAGGATGGCATCATCCTCTGCGAACTTATAAACAAGCTACAGCCAGGCTCAGTG
AAGAAGGTCAACGAGTCCTCACTGAACTGGCCTCAGTTGGAGAATATTGGCAACTTTATTAAAGCTATTC
AGGCTTATGGTATGAAGCCACATGACATATTCGAAGCAAATGATCTTTTTGAGAATGGAAACATGACCCA
GGTTCAGACTACTCTGGTGGCTCTAGCAGGTCTGGCTAAAACAAAAGGATTCCATACAACCATTGACATT
GGAGTTAAGTATGCAGAAAAACAAACAAGACGTTTTGATGAAGGAAAATTAAAAGCTGGCCAAAGTGTAA
TTGGTCTGCAGATGGGAACCAACAAATGTGCCAGCCAGGCAGGTATGACAGCTTACGGGACTAGGAGGCA
TCTTTATGATCCCAAAATGCAAACTGACAAACCTTTTGACCAGACCACAATTAGTCTGCAGATGGGCACT
AATAAAGGAGCCAGCCAGGCAGGGATGTTAGCACCAGGTACCAGAAGAGACATCTATGATCAGAAGCTAA
CATTACAGCCGGTGGACAACTCGACAATTTCCCTACAGATGGGTACCAACAAAGTTGCTTCCCAGAAAGG
AATGAGTGTGTATGGGCTTGGGCGGCAAGTATATGATCCCAAATACTGTGCTGCTCCTACAGAACCTGTC
ATTCACAACGGAAGCCAAGGAACAGGAACAAATGGTTCGGAAATCAGTGATAGTGATTATCAGGCAGAAT
ACCCTGATGAGTATCATGGCGAGTACCAGGATGACTACCCCAGAGATTACCAATATAGCGACCAAGGCAT
TGATTAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200488 protein sequence
Red=Cloning site Green=Tags(s)

MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSV
KKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDI
GVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGT
NKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPV
IHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001839
ORF Size 987 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001839.5
RefSeq Size 2112 bp
RefSeq ORF 990 bp
Locus ID 1266
UniProt ID Q15417
Cytogenetics 1p21.3
Domains calponin, CH
MW 36.4 kDa
Gene Summary This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.