CNTF Receptor alpha (CNTFR) (NM_147164) Human Tagged ORF Clone

CAT#: RC200487

Reviews ()
Write a review

CNTFR (Myc-DDK-tagged)-Human ciliary neurotrophic factor receptor (CNTFR), transcript variant 1



  "NM_147164" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 506.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CNTFR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200487 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCTCCTGTCCCGTGGGCCTGCTGTGCTGTGCTTGCCGCCGCCGCCGCAGTTGTCTACGCCCAGA
GACACAGTCCACAGGAGGCACCCCATGTGCAGTACGAGCGCCTGGGCTCTGACGTGACACTGCCATGTGG
GACAGCAAACTGGGATGCTGCGGTGACGTGGCGGGTAAATGGGACAGACCTGGCCCCTGACCTGCTCAAC
GGCTCTCAGCTGGTGCTCCATGGCCTGGAACTGGGCCACAGTGGCCTCTACGCCTGCTTCCACCGTGACT
CCTGGCACCTGCGCCACCAAGTCCTGCTGCATGTGGGCTTGCCGCCGCGGGAGCCTGTGCTCAGCTGCCG
CTCCAACACTTACCCCAAGGGCTTCTACTGCAGCTGGCATCTGCCCACCCCCACCTACATTCCCAACACC
TTCAATGTGACTGTGCTGCATGGCTCCAAAATTATGGTCTGTGAGAAGGACCCAGCCCTCAAGAACCGCT
GCCACATTCGCTACATGCACCTGTTCTCCACCATCAAGTACAAGGTCTCCATAAGTGTCAGCAATGCCCT
GGGCCACAATGCCACAGCTATCACCTTTGACGAGTTCACCATTGTGAAGCCTGATCCTCCAGAAAATGTG
GTAGCCCGGCCAGTGCCCAGCAACCCTCGCCGGCTGGAGGTGACGTGGCAGACCCCCTCGACCTGGCCTG
ACCCTGAGTCTTTTCCTCTCAAGTTCTTTCTGCGCTACCGACCCCTCATCCTGGACCAGTGGCAGCATGT
GGAGCTGTCCGACGGCACAGCACACACCATCACAGATGCCTACGCCGGGAAGGAGTACATTATCCAGGTG
GCAGCCAAGGACAATGAGATTGGGACATGGAGTGACTGGAGCGTAGCCGCCCACGCTACGCCCTGGACTG
AGGAACCGCGACACCTCACCACGGAGGCCCAGGCTGCGGAGACCACGACCAGCACCACCAGCTCCCTGGC
ACCCCCACCTACCACGAAGATCTGTGACCCTGGGGAGCTGGGCAGCGGCGGGGGACCCTCGGCACCCTTC
TTGGTCAGCGTCCCCATCACTCTGGCCCTGGCTGCCGCTGCCGCCACTGCCAGCAGTCTCTTGATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200487 protein sequence
Red=Cloning site Green=Tags(s)

MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNGTDLAPDLLN
GSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNT
FNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNATAITFDEFTIVKPDPPENV
VARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQV
AAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPF
LVSVPITLALAAAAATASSLLI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_147164
ORF Size 1116 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_147164.3
RefSeq Size 2070 bp
RefSeq ORF 1119 bp
Locus ID 1271
UniProt ID P26992
Cytogenetics 9p13.3
Domains ig, IGc2, IG, FN3
Protein Families Druggable Genome
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
MW 40.6 kDa
Gene Summary This gene encodes a member of the type 1 cytokine receptor family. The encoded protein is the ligand-specific component of a tripartite receptor for ciliary neurotrophic factor, which plays a critical role in neuronal cell survival, differentiation and gene expression. Binding of ciliary neurotrophic factor to the encoded protein recruits the transmembrane components of the receptor, gp130 and leukemia inhibitory factor receptor, facilitating signal transduction. Single nucleotide polymorphisms in this gene may be associated with variations in muscle strength, as well as early onset of eating disorders. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, May 2011]

Other Versions

Other products for "CNTFR"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


CNTFR rabbit polyclonal antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.