glutathione S transferase Omega 1 (GSTO1) (NM_004832) Human Tagged ORF Clone

CAT#: RC200362

Reviews ()
Write a review

GSTO1 (Myc-DDK-tagged)-Human glutathione S-transferase omega 1 (GSTO1), transcript variant 1



Reconstitution Protocol

USD 300.00

USD 450.00

In Stock*

Size
    • 10 ug

Product images

Other products for "GSTO1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GSTO1
Synonyms GSTO 1-1; GSTTLp28; HEL-S-21; P28; SPG-R
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200362 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGGGGAGTCAGCCAGGAGCTTGGGGAAGGGAAGCGCGCCCCCGGGGCCGGTCCCGGAGGGCTCGA
TCCGCATCTACAGCATGAGGTTCTGCCCGTTTGCTGAGAGGACGCGTCTAGTCCTGAAGGCCAAGGGAAT
CAGGCATGAAGTCATCAATATCAACCTGAAAAATAAGCCTGAGTGGTTCTTTAAGAAAAATCCCTTTGGT
CTGGTGCCAGTTCTGGAAAACAGTCAGGGTCAGCTGATCTACGAGTCTGCCATCACCTGTGAGTACCTGG
ATGAAGCATACCCAGGGAAGAAGCTGTTGCCGGATGACCCCTATGAGAAAGCTTGCCAGAAGATGATCTT
AGAGTTGTTTTCTAAGGTGCCATCCTTGGTAGGAAGCTTTATTAGAAGCCAAAATAAAGAAGACTATGCT
GGCCTAAAAGAAGAATTTCGTAAAGAATTTACCAAGCTAGAGGAGGTTCTGACTAATAAGAAGACGACCT
TCTTTGGTGGCAATTCTATCTCTATGATTGATTACCTCATCTGGCCCTGGTTTGAACGGCTGGAAGCAAT
GAAGTTAAATGAGTGTGTAGACCACACTCCAAAACTGAAACTGTGGATGGCAGCCATGAAGGAAGATCCC
ACAGTCTCAGCCCTGCTTACTAGTGAGAAAGACTGGCAAGGTTTCCTAGAGCTCTACTTACAGAACAGCC
CTGAGGCCTGTGACTATGGGCTC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC200362 protein sequence
Red=Cloning site Green=Tags(s)

MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFG
LVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYA
GLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDP
TVSALLTSEKDWQGFLELYLQNSPEACDYGL

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004832
ORF Size 723 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004832.3
RefSeq Size 1017 bp
RefSeq ORF 726 bp
Locus ID 9446
UniProt ID P78417
Cytogenetics 10q25.1
Domains GST_N, GST_C
Protein Families Druggable Genome
Protein Pathways Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450
MW 27.6 kDa
Gene Summary The protein encoded by this gene is an omega class glutathione S-transferase (GST) with glutathione-dependent thiol transferase and dehydroascorbate reductase activities. GSTs are involved in the metabolism of xenobiotics and carcinogens. The encoded protein acts as a homodimer and is found in the cytoplasm. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.