PDCD10 (NM_007217) Human Tagged ORF Clone

CAT#: RC200235

PDCD10 (Myc-DDK-tagged)-Human programmed cell death 10 (PDCD10), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_007217" in other vectors (4)

Reconstitution Protocol

Get a free Anti-DDK antibody sample free with this product. Use code: "DDK-Clone". View details »

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Anti-PDCD10 Rabbit Polyclonal Antibody
    • 100 ul

USD 380.00

Other products for "PDCD10"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PDCD10
Synonyms CCM3; TFAR15
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200235 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGATGACAATGGAAGAGATGAAGAATGAAGCTGAGACCACATCCATGGTTTCTATGCCCCTCTATG
CAGTCATGTATCCTGTGTTTAATGAGCTAGAACGAGTAAATCTGTCTGCAGCCCAGACACTGAGAGCCGC
TTTCATCAAGGCTGAAAAAGAAAATCCAGGTCTCACACAAGACATCATTATGAAAATTTTAGAGAAAAAA
AGCGTGGAAGTTAACTTCACGGAGTCCCTTCTTCGTATGGCAGCTGATGATGTAGAAGAGTATATGATTG
AACGACCAGAGCCAGAATTCCAAGACCTAAACGAAAAGGCACGAGCACTTAAACAAATTCTCAGTAAGAT
CCCAGATGAGATCAATGACAGAGTGAGGTTTCTGCAGACAATCAAGGATATAGCTAGTGCAATAAAAGAA
CTTCTTGATACAGTGAATAATGTCTTCAAGAAATATCAATACCAGAACCGCAGGGCACTTGAACACCAAA
AGAAAGAATTTGTAAAGTACTCCAAAAGTTTCAGTGATACTCTGAAAACGTATTTTAAAGATGGCAAGGC
AATAAATGTGTTCGTAAGTGCCAACCGACTAATTCATCAAACCAACTTAATACTTCAGACCTTCAAAACT
GTGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200235 protein sequence
Red=Cloning site Green=Tags(s)

MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKK
SVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKE
LLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT
VA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007217
ORF Size 636 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007217.4
RefSeq Size 1454 bp
RefSeq ORF 639 bp
Locus ID 11235
UniProt ID Q9BUL8
Cytogenetics 3q26.1
Protein Families Druggable Genome
MW 24.7 kDa
Gene Summary This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.