PDCD10 (NM_007217) Human Tagged ORF Clone

CAT#: RC200235

PDCD10 (Myc-DDK-tagged)-Human programmed cell death 10 (PDCD10), transcript variant 1

Product Images

Western blot validation of overexpression lysate (Cat# LY407854) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC221815 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified PDCD10 protein (Cat# TP300235). The protein was produced from HEK293T cells transfected with PDCD10 cDNA clone (Cat# RC200235) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: PDCD10
• Synonyms: CCM3; TFAR15
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200235 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGGATGACAATGGAAGAGATGAAGAATGAAGCTGAGACCACATCCATGGTTTCTATGCCCCTCTATG
  CAGTCATGTATCCTGTGTTTAATGAGCTAGAACGAGTAAATCTGTCTGCAGCCCAGACACTGAGAGCCGC
  TTTCATCAAGGCTGAAAAAGAAAATCCAGGTCTCACACAAGACATCATTATGAAAATTTTAGAGAAAAAA
  AGCGTGGAAGTTAACTTCACGGAGTCCCTTCTTCGTATGGCAGCTGATGATGTAGAAGAGTATATGATTG
  AACGACCAGAGCCAGAATTCCAAGACCTAAACGAAAAGGCACGAGCACTTAAACAAATTCTCAGTAAGAT
  CCCAGATGAGATCAATGACAGAGTGAGGTTTCTGCAGACAATCAAGGATATAGCTAGTGCAATAAAAGAA
  CTTCTTGATACAGTGAATAATGTCTTCAAGAAATATCAATACCAGAACCGCAGGGCACTTGAACACCAAA
  AGAAAGAATTTGTAAAGTACTCCAAAAGTTTCAGTGATACTCTGAAAACGTATTTTAAAGATGGCAAGGC
  AATAAATGTGTTCGTAAGTGCCAACCGACTAATTCATCAAACCAACTTAATACTTCAGACCTTCAAAACT
  GTGGCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200235 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKK
  SVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKE
  LLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT
  VA
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_007217
• ORF Size: 636 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_007217.4
• RefSeq Size: 1454 bp
• RefSeq ORF: 639 bp
• Locus ID: 11235
• UniProt ID: Q9BUL8
• Cytogenetics: 3q26.1
• Protein Families: Druggable Genome
• MW: 24.7 kDa
• Gene Summary: This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]