DNMT3L (NM_013369) Human Tagged ORF Clone

CAT#: RC200187

DNMT3L (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 1

Change vector?

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DNMT3L (NM_013369) Human Tagged ORF Clone
Symbol DNMT3L
Synonyms MGC1090
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200187 representing NM_013369
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCATCCCAGCCCTGGACCCAGAGGCCGAGCCCAGCATGGACGTGATTTTGGTGGGATCCAGTG
AGCTCTCAAGCTCCGTTTCACCCGGGACAGGCAGAGATCTTATTGCATATGAAGTCAAGGCTAACCAGCG
AAATATAGAAGACATCTGCATCTGCTGCGGAAGTCTCCAGGTTCACACACAGCACCCTCTGTTTGAGGGA
GGGATCTGCGCCCCATGTAAGGACAAGTTCCTGGATGCCCTCTTCCTGTACGACGATGACGGGTACCAAT
CCTACTGCTCCATCTGCTGCTCCGGAGAGACGCTGCTCATCTGCGGAAACCCTGATTGCACCCGATGCTA
CTGCTTCGAGTGTGTGGATAGCCTGGTCGGCCCCGGGACCTCGGGGAAGGTGCACGCCATGAGCAACTGG
GTGTGCTACCTGTGCCTGCCGTCCTCCCGAAGCGGGCTGCTGCAGCGTCGGAGGAAGTGGCGCAGCCAGC
TCAAGGCCTTCTACGACCGAGAGTCGGAGAATCCCCTTGAGATGTTCGAAACCGTGCCTGTGTGGAGGAG
ACAGCCAGTCCGGGTGCTGTCCCTTTTTGAAGACATCAAGAAAGAGCTGACGAGTTTGGGCTTTTTGGAA
AGTGGTTCTGACCCGGGACAACTGAAGCATGTGGTTGATGTCACAGACACAGTGAGGAAGGATGTGGAGG
AGTGGGGACCCTTCGATCTTGTGTACGGCGCCACACCTCCCCTGGGCCACACCTGTGACCGTCCTCCCAG
CTGGTACCTGTTCCAGTTCCACCGGCTCCTGCAGTACGCACGGCCCAAGCCAGGCAGCCCCGGGCCCTTC
TTCTGGATGTTCGTGGACAATCTGGTGCTGAACAAGGAAGACCTGGACGTCGCATCTCGCTTCCTGGAGA
TGGAGCCAGTCACCATCCCAGATGTCCACGGCGGATCCTTGCAGAATGCTGTCCGCGTGTGGAGCAACAT
CCCAGCCATAAGGAGCAGGCACTGGGCTCTGGTTTCGGAAGAAGAATTGTCCCTGCTGGCCCAGAACAAG
CAGAGCTCGAAGCTCGCGGCCAAGTGGCCCACCAAGCTGGTGAAGAACTGCTTTCTCCCCCTAAGAGAAT
ATTTCAAGTATTTTTCAACAGAACTCACTTCCTCTTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200187 representing NM_013369
Red=Cloning site Green=Tags(s)

MAAIPALDPEAEPSMDVILVGSSELSSSVSPGTGRDLIAYEVKANQRNIEDICICCGSLQVHTQHPLFEG
GICAPCKDKFLDALFLYDDDGYQSYCSICCSGETLLICGNPDCTRCYCFECVDSLVGPGTSGKVHAMSNW
VCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVLSLFEDIKKELTSLGFLE
SGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPGPF
FWMFVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNK
QSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_013369
ORF Size 1158 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_013369.1, NM_013369.2, NM_013369.3, NP_037501
RefSeq Size 1705
Locus ID 29947
Cytogenetics 21q22.3
Protein Families Transcription Factors, Druggable Genome
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways
MW 43.5 kDa
Gene Summary CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a nuclear protein with similarity to DNA methyltransferases, but is not thought to function as a DNA methyltransferase as it does not contain the amino acid residues necessary for methyltransferase activity. However, it does stimulate de novo methylation by DNA cytosine methyltransferase 3 alpha and is thought to be required for the establishment of maternal genomic imprints. This protein also mediates transcriptional repression through interaction with histone deacetylase 1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations