DNMT3L (NM_013369) Human Tagged ORF Clone

CAT#: RC200187

Reviews ()
Write a review

DNMT3L (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 1



  "NM_013369" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 616.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DNMT3L
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200187 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCATCCCAGCCCTGGACCCAGAGGCCGAGCCCAGCATGGACGTGATTTTGGTGGGATCCAGTG
AGCTCTCAAGCTCCGTTTCACCCGGGACAGGCAGAGATCTTATTGCATATGAAGTCAAGGCTAACCAGCG
AAATATAGAAGACATCTGCATCTGCTGCGGAAGTCTCCAGGTTCACACACAGCACCCTCTGTTTGAGGGA
GGGATCTGCGCCCCATGTAAGGACAAGTTCCTGGATGCCCTCTTCCTGTACGACGATGACGGGTACCAAT
CCTACTGCTCCATCTGCTGCTCCGGAGAGACGCTGCTCATCTGCGGAAACCCTGATTGCACCCGATGCTA
CTGCTTCGAGTGTGTGGATAGCCTGGTCGGCCCCGGGACCTCGGGGAAGGTGCACGCCATGAGCAACTGG
GTGTGCTACCTGTGCCTGCCGTCCTCCCGAAGCGGGCTGCTGCAGCGTCGGAGGAAGTGGCGCAGCCAGC
TCAAGGCCTTCTACGACCGAGAGTCGGAGAATCCCCTTGAGATGTTCGAAACCGTGCCTGTGTGGAGGAG
ACAGCCAGTCCGGGTGCTGTCCCTTTTTGAAGACATCAAGAAAGAGCTGACGAGTTTGGGCTTTTTGGAA
AGTGGTTCTGACCCGGGACAACTGAAGCATGTGGTTGATGTCACAGACACAGTGAGGAAGGATGTGGAGG
AGTGGGGACCCTTCGATCTTGTGTACGGCGCCACACCTCCCCTGGGCCACACCTGTGACCGTCCTCCCAG
CTGGTACCTGTTCCAGTTCCACCGGCTCCTGCAGTACGCACGGCCCAAGCCAGGCAGCCCCGGGCCCTTC
TTCTGGATGTTCGTGGACAATCTGGTGCTGAACAAGGAAGACCTGGACGTCGCATCTCGCTTCCTGGAGA
TGGAGCCAGTCACCATCCCAGATGTCCACGGCGGATCCTTGCAGAATGCTGTCCGCGTGTGGAGCAACAT
CCCAGCCATAAGGAGCAGGCACTGGGCTCTGGTTTCGGAAGAAGAATTGTCCCTGCTGGCCCAGAACAAG
CAGAGCTCGAAGCTCGCGGCCAAGTGGCCCACCAAGCTGGTGAAGAACTGCTTTCTCCCCCTAAGAGAAT
ATTTCAAGTATTTTTCAACAGAACTCACTTCCTCTTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200187 protein sequence
Red=Cloning site Green=Tags(s)

MAAIPALDPEAEPSMDVILVGSSELSSSVSPGTGRDLIAYEVKANQRNIEDICICCGSLQVHTQHPLFEG
GICAPCKDKFLDALFLYDDDGYQSYCSICCSGETLLICGNPDCTRCYCFECVDSLVGPGTSGKVHAMSNW
VCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVLSLFEDIKKELTSLGFLE
SGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPGPF
FWMFVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNK
QSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_013369
ORF Size 1158 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_013369.4
RefSeq Size 1723 bp
RefSeq ORF 1164 bp
Locus ID 29947
UniProt ID Q9UJW3
Cytogenetics 21q22.3
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways
MW 43.5 kDa
Gene Summary CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a nuclear protein with similarity to DNA methyltransferases, but is not thought to function as a DNA methyltransferase as it does not contain the amino acid residues necessary for methyltransferase activity. However, it does stimulate de novo methylation by DNA cytosine methyltransferase 3 alpha and is thought to be required for the establishment of maternal genomic imprints. This protein also mediates transcriptional repression through interaction with histone deacetylase 1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012]

Other Versions

Other products for "DNMT3L"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Anti-DNMT3L Rabbit Polyclonal Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.