KCTD5 (NM_018992) Human Tagged ORF Clone

CAT#: RC200180

KCTD5 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 5 (KCTD5)

Product Images

Circular map for RC200180

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY KCTD5 (Cat# RC200180, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-KCTD5(Cat# TA501035). Positive lysates LY412830 (100ug) and LC412830 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY412830) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200180 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified KCTD5 protein (Cat# TP300180). The protein was produced from HEK293T cells transfected with KCTD5 cDNA clone (Cat# RC200180) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: KCTD5
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200180 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGAGAATCACTGCGAGCTCCTGTCGCCGGCCCGGGGCGGCATCGGGGCGGGGCTGGGGGGCGGCC
  TGTGCCGCCGCTGCAGCGCTGGGCTCGGCGCCCTGGCCCAGCGCCCTGGCAGCGTGTCCAAGTGGGTCCG
  ACTCAACGTCGGCGGCACCTACTTCCTCACCACTCGGCAGACCCTGTGCCGGGACCCGAAATCCTTCCTG
  TACCGCTTATGCCAGGCCGATCCCGACCTGGACTCAGACAAGGATGAAACAGGCGCCTATTTAATCGACA
  GAGACCCCACCTACTTTGGGCCTGTGCTGAACTACCTGAGACACGGCAAGCTGGTGATTAACAAAGACCT
  CGCGGAGGAAGGAGTGTTGGAGGAAGCAGAATTTTACAATATCACCTCATTAATAAAACTTGTAAAGGAC
  AAAATTAGAGAACGAGACAGCAAAACATCGCAGGTGCCTGTGAAGCATGTGTACCGTGTGCTGCAGTGCC
  AGGAGGAGGAGCTCACGCAGATGGTGTCCACCATGTCCGACGGCTGGAAGTTCGAGCAGTTGGTCAGCAT
  CGGCTCCTCTTACAACTATGGGAACGAAGACCAAGCCGAGTTCCTCTGTGTGGTGTCCAAGGAGCTGCAC
  AACACCCCGTACGGTACGGCCAGCGAGCCCAGCGAGAAGGCCAAGATTTTGCAAGAACGAGGCTCAAGGA
  TG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200180 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFL
  YRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKD
  KIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELH
  NTPYGTASEPSEKAKILQERGSRM
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_018992
• ORF Size: 702 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
• Note: Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required.

Reference Data

• RefSeq: NM_018992.4
• RefSeq Size: 2479 bp
• RefSeq ORF: 705 bp
• Locus ID: 54442
• UniProt ID: Q9NXV2
• Cytogenetics: 16p13.3
• Domains: BTB, K_tetra
• Protein Families: Ion Channels: Other
• MW: 26.1 kDa
• Gene Summary: Its interaction with CUL3 suggests that it may act as a substrate adapter in some E3 ligase complex (PubMed:18573101). Does not affect the function of Kv channel Kv2.1/KCNB1, Kv1.2/KCNA2, Kv4.2/KCND2 and Kv3.4/KCNC4 (PubMed:19361449).[UniProtKB/Swiss-Prot Function]