KCTD5 (NM_018992) Human Tagged ORF Clone

CAT#: RC200180

KCTD5 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 5 (KCTD5)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_018992" in other vectors (7)

Reconstitution Protocol

Get a free Anti-DDK antibody sample free with this product. Use code: "DDK-Clone". View details »

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Anti-KCTD5 mouse monoclonal antibody, clone OTI3C8 (formerly 3C8)
    • 100 ul

USD 478.00

Other products for "KCTD5"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCTD5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200180 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAGAATCACTGCGAGCTCCTGTCGCCGGCCCGGGGCGGCATCGGGGCGGGGCTGGGGGGCGGCC
TGTGCCGCCGCTGCAGCGCTGGGCTCGGCGCCCTGGCCCAGCGCCCTGGCAGCGTGTCCAAGTGGGTCCG
ACTCAACGTCGGCGGCACCTACTTCCTCACCACTCGGCAGACCCTGTGCCGGGACCCGAAATCCTTCCTG
TACCGCTTATGCCAGGCCGATCCCGACCTGGACTCAGACAAGGATGAAACAGGCGCCTATTTAATCGACA
GAGACCCCACCTACTTTGGGCCTGTGCTGAACTACCTGAGACACGGCAAGCTGGTGATTAACAAAGACCT
CGCGGAGGAAGGAGTGTTGGAGGAAGCAGAATTTTACAATATCACCTCATTAATAAAACTTGTAAAGGAC
AAAATTAGAGAACGAGACAGCAAAACATCGCAGGTGCCTGTGAAGCATGTGTACCGTGTGCTGCAGTGCC
AGGAGGAGGAGCTCACGCAGATGGTGTCCACCATGTCCGACGGCTGGAAGTTCGAGCAGTTGGTCAGCAT
CGGCTCCTCTTACAACTATGGGAACGAAGACCAAGCCGAGTTCCTCTGTGTGGTGTCCAAGGAGCTGCAC
AACACCCCGTACGGTACGGCCAGCGAGCCCAGCGAGAAGGCCAAGATTTTGCAAGAACGAGGCTCAAGGA
TG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200180 protein sequence
Red=Cloning site Green=Tags(s)

MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFL
YRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKD
KIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELH
NTPYGTASEPSEKAKILQERGSRM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_018992
ORF Size 702 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_018992.4
RefSeq Size 2479 bp
RefSeq ORF 705 bp
Locus ID 54442
UniProt ID Q9NXV2
Cytogenetics 16p13.3
Domains BTB, K_tetra
Protein Families Ion Channels: Other
MW 26.1 kDa
Gene Summary Its interaction with CUL3 suggests that it may act as a substrate adapter in some E3 ligase complex (PubMed:18573101). Does not affect the function of Kv channel Kv2.1/KCNB1, Kv1.2/KCNA2, Kv4.2/KCND2 and Kv3.4/KCNC4 (PubMed:19361449).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.