EXOSC3 (NM_016042) Human Tagged ORF Clone

CAT#: RC200035

Reviews ()
Write a review

EXOSC3 (Myc-DDK-tagged)-Human exosome component 3 (EXOSC3), transcript variant 1



Reconstitution Protocol

USD 300.00

USD 450.00

In Stock*

Size
    • 10 ug

Product images

Other products for "EXOSC3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol EXOSC3
Synonyms bA3J10.7; CGI-102; hRrp-40; p10; PCH1B; RRP40; Rrp40p
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200035 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGAACCTGCGTCTGTCGCGGCTGAATCTCTCGCGGGCAGCAGGGCGCGCGCTGCACGCACAGTAC
TAGGTCAGGTGGTGCTCCCGGGTGAGGAGCTGCTCCTGCCGGAACAGGAGGACGCGGAAGGCCCTGGGGG
TGCAGTGGAGCGACCGTTGAGCCTGAATGCTAGAGCGTGCTCGCGGGTGCGCGTTGTATGCGGTCCGGGC
CTTCGGCGCTGTGGGGACCGCCTGCTGGTCACCAAGTGCGGCCGCCTCCGTCACAAGGAGCCCGGCAGTG
GCAGCGGCGGCGGTGTTTACTGGGTGGACTCTCAGCAGAAGCGGTATGTTCCAGTAAAAGGAGACCATGT
GATTGGCATAGTGACAGCTAAATCTGGAGATATATTCAAAGTTGATGTTGGAGGGAGTGAGCCAGCTTCT
TTGTCTTACTTGTCATTTGAAGGTGCAACTAAAAGAAACAGACCAAATGTGCAGGTTGGAGATCTCATCT
ATGGCCAATTTGTGGTTGCTAATAAAGACATGGAACCAGAGATGGTCTGTATTGACAGCTGTGGACGAGC
CAATGGAATGGGTGTCATTGGACAGGATGGTCTGCTTTTTAAAGTGACTCTGGGCTTAATTAGAAAGCTA
TTAGCTCCAGATTGTGAAATCATACAGGAAGTGGGAAAACTCTATCCACTGGAGATAGTATTTGGAATGA
ATGGAAGAATATGGGTTAAGGCAAAAACCATCCAGCAGACTTTAATTTTGGCAAACATTTTAGAAGCTTG
TGAACACATGACGTCAGATCAAAGAAAACAGATCTTCTCCAGATTGGCAGAAAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200035 protein sequence
Red=Cloning site Green=Tags(s)

MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPG
LRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPAS
LSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKL
LAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016042
ORF Size 825 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016042.4
RefSeq Size 1857 bp
RefSeq ORF 828 bp
Locus ID 51010
UniProt ID Q9NQT5
Cytogenetics 9p13.2
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation
MW 29.6 kDa
Gene Summary This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2012]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.