Brs3 (NM_009766) Mouse Tagged ORF Clone

CAT#: MR221973

Brs3 (Myc-DDK-tagged) - Mouse bombesin-like receptor 3 (Brs3)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 219.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Brs3 (NM_009766) Mouse Tagged ORF Clone
Symbol Brs3
Synonyms BRS-3
Vector pCMV6-Entry
Sequence Data
>MR221973 representing NM_009766
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCAAAGGCAGTCTCAGTCACCTAATCAGACTTTAATTTCCATTACAAATGACACAGAAACATCAA
GCTCTGTCGTCTCCAACGATACTACACATAAAGGATGGACCGGAGACAACTCTCCAGGAATAGAAGCACT
GTGTGCCATCTATATCACTTATGCTGGGATCATTTCAGTGGGCATCCTCGGAAATGCTATCCTCATCAAA
GTCTTTTTCAAGACTAAATCCATGCAAACAGTTCCAAATATTTTCATCACCAGCCTGGCTTTCGGAGACC
TGTTACTTCTGCTGACTTGTGTGCCTGTGGATGCAACCCACTACCTGGCAGAAGGATGGCTGTTTGGAAA
GGTCGGTTGTAAAGTGCTTTCCTTCATCCGGCTCACTTCTGTCGGTGTGTCAGTGTTCACGCTAACAATT
CTCAGCGCTGACAGATACAAAGCAGTCGTGAAGCCACTTGAGCGACAGCCCCCCAATGCCATTCTGAAGA
CCTGTGCAAAAGCTGGTGGCATCTGGATCGTGTCTATGATATTTGCTCTGCCAGAGGCTATATTCTCAAA
TGTATACACTTTCCAAGATCCTAACAGAAATGTGACATTTGAATCATGTAACTCCTACCCTATCTCTGAG
AGGCTTTTGCAAGAAATACATTCTCTGTTGTGTTTCTTGGTATTCTACATTATCCCGCTCTCGATTATCT
CTGTCTATTATTCTTTGATTGCCAGGACTCTTTACAAAAGCACCCTGAACATACCGACTGAGGAACAAAG
CCATGCCCGAAAGCAGATTGAATCCCGGAAGAGAATTGCCAAAACAGTTTTGGTGCTGGTGGCTCTGTTC
GCACTCTGCTGGTTGCCGAATCATCTCCTGTATCTCTACCACTCCTTCACTTATGAAAGCTATGCAAACC
ACTCTGATGTCCCTTTTGTTATCATCATTTTCTCTCGGGTGCTGGCTTTCAGTAATTCCTGCGTGAACCC
CTTTGCTCTCTATTGGCTGAGCAAGACCTTCCAGCAGCATTTTAAAGCTCAGCTCTGCTGCCTCAAGGCA
GAGCAGCCTGAGCCTCCTCTTGGTGACATCCCCCTTAACAACCTCACTGTGATGGGGCGGGTCCCAGCTA
CTGGGAGTGCACATGTCTCTGAAATTAGTGTGACCCTGTTCAGTGGCAGTAGTGCCAAGAAGGGAGAGGA
CAAAGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR221973 representing NM_009766
Red=Cloning site Green=Tags(s)

MSQRQSQSPNQTLISITNDTETSSSVVSNDTTHKGWTGDNSPGIEALCAIYITYAGIISVGILGNAILIK
VFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGKVGCKVLSFIRLTSVGVSVFTLTI
LSADRYKAVVKPLERQPPNAILKTCAKAGGIWIVSMIFALPEAIFSNVYTFQDPNRNVTFESCNSYPISE
RLLQEIHSLLCFLVFYIIPLSIISVYYSLIARTLYKSTLNIPTEEQSHARKQIESRKRIAKTVLVLVALF
ALCWLPNHLLYLYHSFTYESYANHSDVPFVIIIFSRVLAFSNSCVNPFALYWLSKTFQQHFKAQLCCLKA
EQPEPPLGDIPLNNLTVMGRVPATGSAHVSEISVTLFSGSSAKKGEDKV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_009766
ORF Size 1197 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_009766.1, NM_009766.2, NM_009766.3, NP_033896
RefSeq Size 2772
RefSeq ORF 1200
Locus ID 12209
Cytogenetics X|X A6
MW 44.7 kDa
Gene Summary Role in sperm cell division, maturation, or function. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)