Fanci (NM_145946) Mouse Tagged ORF Clone

CAT#: MR221899

Fanci (Myc-DDK-tagged) - Mouse Fanconi anemia, complementation group I (Fanci)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,700.00


Availability*
6 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Fanci (NM_145946) Mouse Tagged ORF Clone
Symbol Fanci
Synonyms MGC38195; MGC38407
Vector pCMV6-Entry
Sequence Data
>MR221899 representing NM_145946
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCTGAAAATTTTATCTCTAGCAACAGATAAAACTACAGATAAACTGCAGGAGTTTCTTCAAACCC
TGAAAGATGATGATTTGGCCAGTCTCCTTCAGAACCAAGCGGTGAAAGGAAGAGCTGTTGGAACGCTCCT
GAGAGCCGTCCTCAAAGGCTCCCCCTGCTCTGAGGAAGATGGAGCCCTTAGGAGATACAAGATATATTCT
TGCTGTATCCAGTTGGTTGAATCGGGAGATTTGCAGCAAGATGTCGCATCAGAGATCATAGGATTACTAA
TGCTGGAGGTCCACCATTTTCCAGGCCCATTACTTGTTGACTTGGCTAGTGACTTTGTGGGTGCTGTCCG
AGAGGACCGCCTAGTGAATGGAAAATCTTTGGAGTTATTACCCATCATCCTTACTGCCTTGGCCACCAAG
AAGGAAGTCCTCGCTTGTGGGAAAGGTGATTTGAATGGGGAAGAATATAAGAGGCAGTTGATTGACACCC
TGTGTTCTGTCAGATGGCCTCAACGGTACATGATCCAGCTCACTTCTGTGTTCAAGGATGTCTGTCTAAC
GCCAGAAGAGATGAATCTCGTGGTGGCCAAAGTGTTGACGATGTTCTCAAAGTTGAATCTTCAAGAAATT
CCACCTTTGGTCTATCAGCTTCTGGTTCTCTCTTCCAAGGGAAGCAGAAGGAGTGTTCTGGACGGAATCA
TAGCCTTCTTCAGGGAGCTGGATAAGCAGCACAGGGAGGAACAGAGCAGCGATGAGTTGTCAGAGCTTAT
TACTGCCCCAGCAGACGAACTCTATCACGTGGAAGGCACCGTTATTCTGCACATCGTATTTGCCATCAAA
CTGGACTGTGAATTAGGCAGAGAACTTCTGAAACACTTGAAGGCTGGACAGCAGGGGGATCCCAGTAAAT
GCCTATGTCCCTTCAGCATCGCTCTTCTCCTCTCTCTCACGAGAATACAGAGATTTGAGGAACAGGTGTT
TGATCTTTTAAAGACTTCTGTTGTAAAAAGCTTCAAGGATCTTCAGCTCCTCCAAGGCTCCAAGTTTCTT
CAGACTCTCGTCCCCCAGAGAACTTGTGTTTCAACCATGATCTTAGAAGTGGTGAGGAACAGTGTTCATA
GTTGGGATCATGTAACTCAAGGTCTGATAGAATTTGGTTTCATCTTGATGGATTCCTATGGGCCAAAGAA
GATTCTTGATGGAAAAGCTGTTGAAATTGGCACCAGTCTTTCTAAAATGACAAACCAGCACGCATGTAAG
CTGGGAGCTAATATCTTATTGGAAACCTTTAAAATCCACGAGATGATCAGACAAGAAATTCTGGAGCAAG
TCCTCAACAGAGTTGTTACGCGAACATCCTCTCCCATCAATCATTTCTTAGACTTGTTTTCAGATATCAT
CATGTATGCACCTTTAATTCTTCAGAACTGTTCAAAAGTCACGGAAACTTTTGACTATTTGACCTTTCTG
CCCCTCCAGACCGTGCAAGGGCTGCTCAAGGCGGTGCAGCCGCTTCTCAAGATCAGCATGTCGATGAGAG
ACTCCTTGATCCTCGTCTTGCGGAAAGCTATGTTTGCCAGCCAGCTGGATGCCCGGAAATCTGCAGTTGC
TGGGTTTTTGCTGCTCCTAAAGAACTTTAAAGTCCTAGGCAGCCTGCCGTCCTCACAGTGCACACAGTCT
ATTGGTGTCACGCAGGTGCGCGTGGACGTTCACAGCCGATACAGCGCTGTCGCCAACGAGACCTTCTGCC
TTGAGATCATAGACAGCTTGAAACGAAGCTTAGGGCAGCAGGCAGACATCCGGCTCATGCTTTACGACGG
TTTCTACGATGTCCTTCGACGGAACTCTCAGCTGGCTAGTTCAATCATGCAGACTCTCTTCTCACAGTTA
AAACAGTTCTATGAGCCAGAGCCTGATCTGCTACCTCCTCTGAAACTAGGAGCTTGTGTTCTGACCCAAG
GAAGTCAGATCTTTCTACAAGAGCCGCTGGATCATCTGCTGTCTTGCATTCAGCATTGCTTGGCCTGGTA
TAAGAGCAGAGTCGTCCCCCTGCAACAAGGAGATGAAGGAGAGGAGGAGGAGGAGGAGTTGTACTCCGAG
CTGGATGATATGTTGGAGTCCATTACTGTCAGAATGATCAAGAGTGAGCTGGAAGACTTTGAGCTGGATA
AATCAGCAGATTTCTCTCAGAACACTAATGTCGGCATCAAGAATAATATCTGTGCGTGTCTCATCATGGG
AGTGTGTGAAGTTCTAATGGAATATAATTTCTCCATAAGTAACTTCAGCAAGAGTAAGTTTGAGGAGATC
CTGAGCCTCTTCACATGTTACAAGAAGTTCTCTGACATCCTCAGTGAGAAAGCTGGCAAAGGCAAGGCTA
AGATGACCAGTAAAGTCAGCGACAGTCTCCTGTCCTTGAAGTTTGTGTCTGATCTCCTCACTGCTCTCTT
CAGAGACAGCATCCAGAGTCATGAAGAGAGTCTGTCTGTCCTGCGGTCCAGCGGCGAGTTTATGCACTAT
GCAGTGAACGTCACTTTGCAGAAGATTCAGCAGCTAATACGAACAGGGCATGTGAGTGGCCCTGATGGTC
AGAACCCAGACAAGATCTTTCAGAACCTCTGTGACATAACTCGGGTCCTGCTGTGGAGATACACATCAAT
TCCTACATCCGTGGAGGAGTCGGGGAAGAAGGAGAAGGGAAAGAGCATCTCGCTGTTGTGCTTGGAGGGC
TTGCAGAAGACGTTCAGTGTGGTGCTGCAGTTCTACCAGCCCAAGGTCCAGCAGTTTCTCCAGGCTCTGG
ATGTCATGGGCACAGAAGAAGAAGAAGCAGGTGTCACTGTCACTCAGAGGGCCTCGTTCCAGATCCGGCA
GTTTCAGAGGTCGTTGTTGAATCTGCTGAGCAGCGAAGAGGACGATTTTAACAGTAAAGAGGCCCTCCTG
CTCATCGCGGTGCTGTCCACCTTGTCCAGGCTGCTGGAGCCCACCTCTCCTCAGTTTGTGCAGATGTTAT
CCTGGACATCTAAGATTTGCAAGGAATACAGCCAGGAGGATGCCTCATTTTGCAAGAGTTTGATGAACCT
GTTCTTCAGCCTGCATGTCTTATATAAGAGTCCTGTCACCCTGCTTCGTGACTTGTCCCAGGATATCCAT
GGGCAGCTGGGAGACATAGATCAAGATGTAGAGATTGAGAAGACAGACCACTTTGCTGTGGTGAATTTGA
GAACGGCTGCCCCCACTGTCTGTTTACTTGTTCTGAGTCAGGCTGAGAAAGTCCTAGAAGAAGTGGACTG
GTTAATCGCCAAGATCAAGGGCTCAGCAAACCAAGAAACGCTATCAGATAAAGTGACTCCAGAAGATGCC
TCTTCTCAAGCCGTTCCACCAACTCTTCTCATTGAGAAAGCTATCGTCATGCAACTGGGAACTCTGGTAA
CGTTCTTCCATGAGCTCGTGCAGACAGCCCTGCCATCAGGCAGCTGTGTAGACACTCTACTGAAGGGCCT
GTCCAAGATCTACAGCACCCTAACAGCATTCGTCAAATATTATCTCCAGGTATGTCAGAGCTCCAGAGGA
ATTCCAAACACTGTGGAAAAACTGGTGAAGCTGTCGGGCTCTCATCTGACCCCCGTATGTTACTCTTTCA
TTTCTTATGTACAAAATAAGAGCAGTGACGCCCCAAAGTGCTCAGAAAAGGAGAAGGCTGCAGTGAGCAC
AACCATGGCCAAAGTTCTTCGTGAAACCAAGCCAATCCCTAACCTTGTCTTTGCCATTGAACAGTATGAA
AAATTTCTTATCCAACTGTCTAAAAAGTCCAAGGTAAACCTGATGCAGCACATGAAGCTGAGTACTTCTC
GGGACTTCAAGATCAAAGGCAGTGTCCTCGACATGGTTCTTCGAGAGGATGAGGAAGACGAAAACGAAGA
GGGCACTGCATCAGCACATACACAGCAGGACAGAGAACCAGCCAAGAAGAGGAGGAAGAAATGCCTGAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR221899 representing NM_145946
Red=Cloning site Green=Tags(s)

MDLKILSLATDKTTDKLQEFLQTLKDDDLASLLQNQAVKGRAVGTLLRAVLKGSPCSEEDGALRRYKIYS
CCIQLVESGDLQQDVASEIIGLLMLEVHHFPGPLLVDLASDFVGAVREDRLVNGKSLELLPIILTALATK
KEVLACGKGDLNGEEYKRQLIDTLCSVRWPQRYMIQLTSVFKDVCLTPEEMNLVVAKVLTMFSKLNLQEI
PPLVYQLLVLSSKGSRRSVLDGIIAFFRELDKQHREEQSSDELSELITAPADELYHVEGTVILHIVFAIK
LDCELGRELLKHLKAGQQGDPSKCLCPFSIALLLSLTRIQRFEEQVFDLLKTSVVKSFKDLQLLQGSKFL
QTLVPQRTCVSTMILEVVRNSVHSWDHVTQGLIEFGFILMDSYGPKKILDGKAVEIGTSLSKMTNQHACK
LGANILLETFKIHEMIRQEILEQVLNRVVTRTSSPINHFLDLFSDIIMYAPLILQNCSKVTETFDYLTFL
PLQTVQGLLKAVQPLLKISMSMRDSLILVLRKAMFASQLDARKSAVAGFLLLLKNFKVLGSLPSSQCTQS
IGVTQVRVDVHSRYSAVANETFCLEIIDSLKRSLGQQADIRLMLYDGFYDVLRRNSQLASSIMQTLFSQL
KQFYEPEPDLLPPLKLGACVLTQGSQIFLQEPLDHLLSCIQHCLAWYKSRVVPLQQGDEGEEEEEELYSE
LDDMLESITVRMIKSELEDFELDKSADFSQNTNVGIKNNICACLIMGVCEVLMEYNFSISNFSKSKFEEI
LSLFTCYKKFSDILSEKAGKGKAKMTSKVSDSLLSLKFVSDLLTALFRDSIQSHEESLSVLRSSGEFMHY
AVNVTLQKIQQLIRTGHVSGPDGQNPDKIFQNLCDITRVLLWRYTSIPTSVEESGKKEKGKSISLLCLEG
LQKTFSVVLQFYQPKVQQFLQALDVMGTEEEEAGVTVTQRASFQIRQFQRSLLNLLSSEEDDFNSKEALL
LIAVLSTLSRLLEPTSPQFVQMLSWTSKICKEYSQEDASFCKSLMNLFFSLHVLYKSPVTLLRDLSQDIH
GQLGDIDQDVEIEKTDHFAVVNLRTAAPTVCLLVLSQAEKVLEEVDWLIAKIKGSANQETLSDKVTPEDA
SSQAVPPTLLIEKAIVMQLGTLVTFFHELVQTALPSGSCVDTLLKGLSKIYSTLTAFVKYYLQVCQSSRG
IPNTVEKLVKLSGSHLTPVCYSFISYVQNKSSDAPKCSEKEKAAVSTTMAKVLRETKPIPNLVFAIEQYE
KFLIQLSKKSKVNLMQHMKLSTSRDFKIKGSVLDMVLREDEEDENEEGTASAHTQQDREPAKKRRKKCLS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_145946
ORF Size 3990 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_145946.2, NP_666058
RefSeq Size 4621
RefSeq ORF 3993
Locus ID 208836
Cytogenetics 7|7 D2
MW 149.8 kDa
Gene Summary Plays an essential role in the repair of DNA double-strand breaks by homologous recombination and in the repair of interstrand DNA cross-links (ICLs) by promoting FANCD2 monoubiquitination by FANCL and participating in recruitment to DNA repair sites. Required for maintenance of chromosomal stability. Specifically binds branched DNA: binds both single-stranded DNA (ssDNA) and double-stranded DNA (dsDNA). Participates in S phase and G2 phase checkpoint activation upon DNA damage. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)