Fancd2 (NM_001033244) Mouse Tagged ORF Clone

CAT#: MR220802

Fancd2 (Myc-DDK-tagged) - Mouse Fanconi anemia, complementation group D2 (Fancd2)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 1,844.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Fancd2 (NM_001033244) Mouse Tagged ORF Clone
Symbol Fancd2
Synonyms 2410150O07Rik; AU015151; BB137857; FA-D2; FA4; FACD; FAD; FANCD
Vector pCMV6-Entry
Sequence Data
>MR220802 representing NM_001033244
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTTCCAAAAGACGTCGGCTAGATTCTGAGGATAAAGAAAACCTGACAGAAGATGCCTCCAAAACCA
TGCCCCTTTCCAAGCTGGCAAAGAAGTCTCACAATTCTCATGAAGTTGAAGAAAATGGCAGTGTCTTTGT
AAAGCTTCTTAAGGCTTCAGGACTCACTCTTAAAACTGGAGAGAACCAAAATCAGCTAGGTGTGGATCAG
GTAATCTTCCAAAGGAAGCTCTTTCAGGCCTTGAGGAAGCATCCTGCTTATCCCAAAGTAATAGAAGAGT
TTGTTAATGGCCTGGAGTCCTACACTGAGGACAGTGAGAGTCTCAGGAACTGCCTGCTGTCTTGTGAGCG
CCTGCAGGATGAGGAAGCCAGCATGGGCACATTTTACTCCAAGAGTCTGATCAAGCTACTTCTGGGGATT
GACATTTTACAGCCTGCCATTATCAAAATGTTATTTGAAAAAGTGCCTCAGTTTCTTTTTGAAAGTGAGA
ACAGAGATGGAATCAACATGGCCAGACTCATTATCAATCAACTAAAATGGCTGGATAGAATTGTGGATGG
CAAGGACCTCACGGCCCAGATGATGCAGTTGATCAGTGTTGCTCCCGTGAACTTACAGCATGACTTCATC
ACGAGCCTTCCTGAAATCCTAGGGGATTCCCAGCATGCTAATGTGGGGAAAGAGCTTGGCGAGCTGCTGG
TGCAGAATACTTCCCTGACTGTTCCAATTTTGGATGTCTTTTCCAGTCTCCGACTTGACCCCAACTTCCT
GTCCAAGATCCGCCAGTTGGTGATGGGCAAGCTGTCATCTGTCCGTCTAGAGGATTTCCCTGTGATTGTA
AAGTTCCTTCTTCATTCTGTAACAGACACCACTTCCCTTGAGGTCATTGCCGAGCTTCGGGAGAACTTGA
ACGTCCAGCAGTTTATTTTGCCGTCACGAATTCAGGCTTCCCAAAGCAAATTGAAAAGTAAAGGACTAGC
AAGCTCTTCAGGAAATCAAGAGAACAGTGATAAAGACTGTATTGTTCTTGTCTTTGATGTAATAAAGTCA
GCCATTAGATATGAGAAAACCATTTCAGAGGCCTGGTTTAAGGCAATTGAACGCATTGAGTCCGCGGCTG
AACATAAGGCTTTGGACGTGGTCATGCTGCTCATCATCTACAGCACCAGCACGCAGACCAAGAAGGGCGT
GGAGAAGCTGCTGAGAAACAAGATTCAGTCAGACTGCATTCAAGAACAGCTGCTTGACAGTGCGTTCTCT
ACACATTACCTGGTTCTTAAGGATATTTGCCCATCTATTCTTTTGCTGGCTCAGACTTTGTTTCACTCTC
AAGACCAGAGGATCATTTTGTTTGGCAGTCTTCTGTACAAATATGCTTTTAAGTTTTTTGATACTTACTG
CCAGCAGGAAGTGGTTGGTGCCCTAGTCACCCATGTCTGCAGTGGGACTGAGGCTGAAGTCGACACTGCA
CTGGATGTCCTCCTGGAGCTGATTGTGCTAAACGCCTCTGCTATGAGGCTCAATGCTGCTTTTGTTAAGG
GCATCTTAGATTATTTGGAAAATATGTCCCCTCAGCAAATACGAAAAATCTTCTGTATTCTCAGCACTCT
TGCATTTAGCCAACAGCCCGGAACCAGCAACCATATCCAGGACGACATGCACCTGGTGATCCGGAAGCAG
CTCTCTAGCACTGTGTTCAAGTACAAGCTCATTGGGATCATTGGTGCAGTCACCATGGCCGGCATCATGG
CGGAAGACAGAAGTGTACCATCTAACTCATCCCAGAGGAGCGCCAATGTGAGCAGTGAGCAGCGCACACA
GGTGACTTCTTTGCTACAACTAGTTCATTCTTGCACTGAGCACTCTCCTTGGGCCTCTTCTCTGTATTAT
GATGAATTTGCCAACCTGATCCAAGAAAGGAAGTTGGCTCCAAAAACCTTGGAGTGGGTTGGGCAGACCA
TCTTCAATGATTTCCAAGATGCCTTTGTGGTAGACTTCTGTGCTGCTCCAGAGGGTGACTTTCCATTTCC
TGTGAAAGCGCTCTATGGACTGGAAGAGTACAGCACTCAAGACGGCATTGTCATCAACCTCCTGCCGCTG
TTCTATCAGGAATGTGCAAAAGATGCCAGTCGAGCGACATCACAAGAATCGAGCCAGAGATCAATGTCTT
CTTTGTGCCTGGCTTCCCATTTCCGGCTGCTGAGACTTTGCGTGGCAAGACAACATGATGGAAACTTGGA
TGAGATCGATGGTCTCTTAGATTGTCCCCTGTTCCTCCCTGACCTGGAACCTGGAGAGAAACTGGAGTCC
ATGTCTGCTAAAGACCGTTCGCTTATGTGTTCGCTCACATTCCTAACTTTCAACTGGTTCCGAGAGGTTG
TGAATGCCTTCTGCCAACAAACATCTCCTGAGATGAAGGGCAAGGTTCTTAGTCGGCTAAAGGACCTTGT
AGAACTTCAGGGAATCCTAGAGAAGTACTTGGCAGTCATCCCAGACTATGTTCCGCCTTTCGCAAGCGTT
GACTTGGACACTTTAGATATGATGCCTAGGAGCAGTTCTGCTGTTGCAGCAAAAAACAGAAACAAGGGAA
AGACGGGGGGAAAGAAACAAAAAGCTGATAGCAACAAAGCATCCTGTTCGGACACACTTCTAACAGAAGA
CACTTCAGAGTGTGACATGGCGCCATCTGGGAGAAGCCACGTAGACAAGGAGTCCACAGGGAAGGAAGGA
AAGACGTTTGTGTCACTGCAGAATTACCGCGCTTTTTTCCGAGAGCTGGACATTGAGGTCTTCTCTATTC
TACATTCTGGACTTGTGACCAAGTTCATCTTAGACACTGAAATGCACACTGAAGCTACAGAGGTCGTACA
GCTGGGGCCTGCTGAGCTGCTCTTCTTGCTGGAAGATCTTTCCCAGAAGCTAGAGAATATGCTGACTGCT
CCTTTTGCCAAGAGAATCTGCTGCTTTAAGAATAAAGGAAGGCAGAATATTGGCTTCTCACATCTTCATC
AGAGATCTGTCCAGGACATTGTGCACTGTGTGGTTCAGCTGCTAACCCCGATGTGTAACCATCTGGAGAA
CATTCACAACTTCTTTCAGTGCTTAGGTGCTGAGCATCTCAGTGCAGATGACAAGGCGAGAGCGACAGCT
CAGGAGCAGCACACCATGGCCTGCTGCTACCAGAAGCTGCTGCAGGTCTTGCACGCGCTCTTTGCGTGGA
AGGGATTTACTCACCAATCAAAGCACCGCCTCCTGCACTCAGCCCTTGAGGTCCTCTCGAACCGACTAAA
GCAGATGGAACAGGACCAGCCCTTGGAGGAACTGGTCAGCCAGAGCTTCAGTTACTTGCAGAACTTCCAC
CATAGTGTTCCCAGTTTCCAGTGTGGTCTCTACCTTCTCAGACTTCTGATGGCCCTTCTGGAGAAGTCTG
CAGTACCTAACCAGAAGAAAGAAAAACTTGCCTCTCTGGCCAAACAGCTGCTTTGCCGAGCATGGCCTCA
TGGGGAAAAAGAGAAGAACCCCACTTTTAATGACCACCTGCATGATGTGCTTTACATCTACTTGGAGCAC
ACAGACAATGTTCTGAAGGCCATAGAGGAGATCACTGGTGTTGGTGTCCCAGAACTGGTCAGTGCTCCGA
AAGACGCCGCCTCCTCTACATTCCCTACGTTGACCAGGCACACCTTTGTCATATTCTTCCGTGTGATGAT
GGCTGAACTCGAGAAGACGGTGAAGGGTCTTCAGGCTGGCACAGCAGCAGATTCGCAGCAGGTTCACGAA
GAGAAGCTCCTCTATTGGAACATGGCTGTCCGAGATTTCAGCATCCTTCTCAATCTGATGAAAGTATTTG
ACAGTTATCCTGTTCTGCATGTGTGTTTAAAGTATGGCCGTCGCTTTGTGGAGGCATTTCTGAAGCAATG
TATGCCACTCCTCGACTTCAGCTTTAGAAAGCATCGGGAAGATGTTCTGAGCTTGCTGCAAACCCTTCAG
TTGAACACGAGGCTACTTCATCACCTTTGTGGACACTCCAAGATTCGCCAGGACACAAGACTCACCAAGC
ATGTGCCTTTACTCAAAAAGTCACTGGAACTGTTAGTTTGCAGAGTCAAAGCCATGCTTGTCCTCAACAA
CTGTAGAGAGGCTTTCTGGTTGGGTACTCTCAAAAACCGAGACTTACAGGGTGAAGAAATTATTTCCCAG
GATCCCTCTTCCTCAGAGAGCAATGCAGAGGACAGTGAGGATGGCGTGACATCTCACGTCTCCAGGAACA
GAGCAACAGAGGATGGGGAAGATGAAGCAAGTGATGAACAGAAGGACCAGGACAGTGATGAAAGTGACGA
CAGCTCCAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR220802 representing NM_001033244
Red=Cloning site Green=Tags(s)

MISKRRRLDSEDKENLTEDASKTMPLSKLAKKSHNSHEVEENGSVFVKLLKASGLTLKTGENQNQLGVDQ
VIFQRKLFQALRKHPAYPKVIEEFVNGLESYTEDSESLRNCLLSCERLQDEEASMGTFYSKSLIKLLLGI
DILQPAIIKMLFEKVPQFLFESENRDGINMARLIINQLKWLDRIVDGKDLTAQMMQLISVAPVNLQHDFI
TSLPEILGDSQHANVGKELGELLVQNTSLTVPILDVFSSLRLDPNFLSKIRQLVMGKLSSVRLEDFPVIV
KFLLHSVTDTTSLEVIAELRENLNVQQFILPSRIQASQSKLKSKGLASSSGNQENSDKDCIVLVFDVIKS
AIRYEKTISEAWFKAIERIESAAEHKALDVVMLLIIYSTSTQTKKGVEKLLRNKIQSDCIQEQLLDSAFS
THYLVLKDICPSILLLAQTLFHSQDQRIILFGSLLYKYAFKFFDTYCQQEVVGALVTHVCSGTEAEVDTA
LDVLLELIVLNASAMRLNAAFVKGILDYLENMSPQQIRKIFCILSTLAFSQQPGTSNHIQDDMHLVIRKQ
LSSTVFKYKLIGIIGAVTMAGIMAEDRSVPSNSSQRSANVSSEQRTQVTSLLQLVHSCTEHSPWASSLYY
DEFANLIQERKLAPKTLEWVGQTIFNDFQDAFVVDFCAAPEGDFPFPVKALYGLEEYSTQDGIVINLLPL
FYQECAKDASRATSQESSQRSMSSLCLASHFRLLRLCVARQHDGNLDEIDGLLDCPLFLPDLEPGEKLES
MSAKDRSLMCSLTFLTFNWFREVVNAFCQQTSPEMKGKVLSRLKDLVELQGILEKYLAVIPDYVPPFASV
DLDTLDMMPRSSSAVAAKNRNKGKTGGKKQKADSNKASCSDTLLTEDTSECDMAPSGRSHVDKESTGKEG
KTFVSLQNYRAFFRELDIEVFSILHSGLVTKFILDTEMHTEATEVVQLGPAELLFLLEDLSQKLENMLTA
PFAKRICCFKNKGRQNIGFSHLHQRSVQDIVHCVVQLLTPMCNHLENIHNFFQCLGAEHLSADDKARATA
QEQHTMACCYQKLLQVLHALFAWKGFTHQSKHRLLHSALEVLSNRLKQMEQDQPLEELVSQSFSYLQNFH
HSVPSFQCGLYLLRLLMALLEKSAVPNQKKEKLASLAKQLLCRAWPHGEKEKNPTFNDHLHDVLYIYLEH
TDNVLKAIEEITGVGVPELVSAPKDAASSTFPTLTRHTFVIFFRVMMAELEKTVKGLQAGTAADSQQVHE
EKLLYWNMAVRDFSILLNLMKVFDSYPVLHVCLKYGRRFVEAFLKQCMPLLDFSFRKHREDVLSLLQTLQ
LNTRLLHHLCGHSKIRQDTRLTKHVPLLKKSLELLVCRVKAMLVLNNCREAFWLGTLKNRDLQGEEIISQ
DPSSSESNAEDSEDGVTSHVSRNRATEDGEDEASDEQKDQDSDESDDSSS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001033244
ORF Size 4350 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001033244.1, NM_001033244.2, NM_001033244.3, NP_001028416
RefSeq Size 4780
RefSeq ORF 4353
Locus ID 211651
Cytogenetics 6|6 E3
MW 164.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)