Mgst2 (NM_174995) Mouse Tagged ORF Clone

SKU
MR213605
Mgst2 (Myc-DDK-tagged) - Mouse microsomal glutathione S-transferase 2 (Mgst2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Mgst2
Synonyms GST2; MGST-II
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR213605 representing NM_174995
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGGGGATTCAAGCCTGCTGGCTGCAGTCTCTCTTCTCTCTGCCTGTCAGCAAAGTTATTTCGCTT
GGCGGGTCGGACGAGCAAGACTAAAACACAAGATTGCACCCCCAGCAGTCACGGGCCCTCTGGAATTCGA
GAGAATATTTCGTGCACAGCAAAACTCTTTGGAGTTTTATCCTGTATTCATCGTAATGCTGTGGATGGCT
GGGTGGTACTTCAATCAAGTTTTTGCAGCCTGTCTGGGTCTCCTGTACATATACGCCCGTCACAAGTATT
TCTGGGGCTATGCCGAAGCCGCTGAGAAAAGGATCACCGGTTTCCGACTGAGCCTGGGGATTTTGACCTT
GCTGCCTGTCCTCGCTGTCCTGGGGGTAGCAAGCAGATTCCTGAACGAATACCTGGACTTTCATGTTGCC
AAGAAACTGAGGAAGCCCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR213605 representing NM_174995
Red=Cloning site Green=Tags(s)

MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAQQNSLEFYPVFIVMLWMA
GWYFNQVFAACLGLLYIYARHKYFWGYAEAAEKRITGFRLSLGILTLLPVLAVLGVASRFLNEYLDFHVA
KKLRKPF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_174995
ORF Size 441 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_174995.3, NP_778160.2
RefSeq Size 614 bp
RefSeq ORF 444 bp
Locus ID 211666
UniProt ID A2RST1
Cytogenetics 3 C
MW 16.8 kDa
Summary Catalyzes several different glutathione-dependent reactions. Catalyzes the glutathione-dependent reduction of lipid hydroperoxides, such as 5-HPETE. Has glutathione transferase activity, toward xenobiotic electrophiles, such as 1-chloro-2, 4-dinitrobenzene (CDNB). Catalyzes also the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4 (LTC4) (By similarity). Involved in oxidative DNA damage induced by ER stress and anticancer agents by activating LTC4 biosynthetic machinery in nonimmune cells (PubMed:26656251).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Mgst2 (NM_174995) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC212564 Mgst2 (untagged) - Mouse microsomal glutathione S-transferase 2 (Mgst2), (10ug) 10 ug
$165.00
MG213605 Mgst2 (tGFP-tagged) - Mouse microsomal glutathione S-transferase 2 (Mgst2), (10ug) 10 ug
$350.00
MR213605L3 Lenti ORF clone of Mgst2 (Myc-DDK-tagged) - Mouse microsomal glutathione S-transferase 2 (Mgst2) 10 ug
$450.00
MR213605L4 Lenti ORF clone of Mgst2 (mGFP-tagged) - Mouse microsomal glutathione S-transferase 2 (Mgst2) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.