Abcg2 (NM_011920) Mouse Tagged ORF Clone

CAT#: MR209819

Abcg2 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family G (WHITE), member 2 (Abcg2)

Change vector?

  • TrueORF®

USD 98

USD 810


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Abcg2 (NM_011920) Mouse Tagged ORF Clone
Symbol Abcg2
Synonyms ABC15; ABCP; AI428558; BCRP; Bcrp1; MXR; MXR1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR209819 representing NM_011920
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTCCAGTAATGACCACGTGTTAGTACCAATGTCGCAGAGAAACAACAACGGCCTTCCTAGGACGA
ACTCCAGAGCCGTTAGGACGCTCGCAGAAGGAGATGTGTTGAGTTTTCATCACATCACCTATCGAGTGAA
AGTAAAGAGTGGGTTTCTAGTCCGGAAAACAGTTGAGAAAGAAATACTATCAGATATCAATGGGATCATG
AAACCTGGCCTTAATGCTATTCTGGGACCCACAGGCGGAGGCAAGTCTTCGTTGCTAGATGTCTTAGCAG
CAAGGAAAGATCCAAAGGGATTATCTGGAGATGTTTTGATAAATGGAGCACCTCAACCTGCCCACTTCAA
ATGCTGTTCAGGTTATGTGGTTCAAGATGACGTTGTGATGGGCACCCTGACAGTGAGAGAAAACTTACAG
TTCTCAGCAGCTCTTCGACTTCCAACAACTATGAAGAATCATGAAAAAAATGAACGGATTAACACAATCA
TTAAAGAGTTAGGTCTGGAAAAAGTAGCAGATTCTAAGGTCGGAACTCAGTTTATCCGTGGCATCTCTGG
AGGAGAAAGAAAAAGGACAAGCATAGGGATGGAGCTGATCACTGACCCTTCCATCCTCTTCCTGGATGAG
CCCACGACTGGTTTGGACTCAAGCACAGCGAATGCTGTCCTTTTGCTCCTGAAAAGGATGTCTAAACAGG
GTCGAACAATCATCTTCTCCATTCATCAGCCTCGGTATTCCATCTTTAAGCTGTTTGACAGCCTCACCTT
ACTGGCTTCCGGGAAACTCGTGTTCCATGGGCCAGCACAGAAGGCCTTGGAGTACTTTGCATCAGCAGGT
TACCACTGTGAGCCCTACAACAACCCTGCGGATTTTTTCCTTGATGTCATCAATGGAGATTCTTCTGCTG
TGATGTTAAATAGAGAGGAACAAGACAATGAAGCAAACAAGACTGAAGAGCCTTCCAAGGGAGAGAAGCC
AGTAATAGAAAATTTATCTGAGTTTTATATCAACTCTGCCATCTATGGAGAAACAAAAGCTGAATTAGAT
CAACTTCCAGGAGCTCAGGAAAAGAAAGGAACATCGGCCTTCAAAGAGCCAGTCTATGTTACCTCTTTCT
GTCACCAGCTCCGATGGATTGCCAGGCGCTCATTTAAAAACTTGCTCGGGAACCCTCAAGCTTCTGTTGC
TCAGTTAATTGTTACAGTCATACTGGGGCTTATTATTGGTGCCATTTACTTTGATCTGAAATATGATGCC
GCTGGAATGCAAAATAGAGCTGGAGTTTTGTTTTTCCTGACTACCAACCAGTGTTTTTCCAGTGTGTCAG
CTGTGGAGCTGTTCGTAGTGGAGAAGAAACTCTTCATACATGAGTACATCAGTGGATATTACAGAGTGTC
TTCTTACTTCTTTGGAAAGGTGATGTCTGATTTACTCCCCATGAGGTTCTTGCCAAGTGTTATATTCACT
TGTGTATTATACTTCATGTTAGGACTGAAGAAGACGGTGGATGCTTTTTTCATCATGATGTTTACCCTTA
TAATGGTGGCTTATACGGCCAGTTCCATGGCACTGGCCATAGCCACAGGCCAAAGTGTGGTGTCTGTAGC
AACACTTCTCATGACAATCGCTTTTGTATTTATGATGCTCTTTTCTGGCCTCTTGGTGAATCTCAGAACC
ATTGGGCCTTGGCTGTCCTGGCTTCAGTACTTTAGCATTCCTCGATATGGCTTCACAGCTTTGCAGTATA
ATGAATTCTTGGGACAAGAGTTTTGTCCAGGATTCAATGTAACGGACAACAGCACTTGTGTTAACAGCTA
TGCAATATGTACTGGTAACGAGTACTTGATAAATCAGGGCATCGAACTGTCACCTTGGGGACTGTGGAAG
AATCATGTGGCCCTGGCTTGTATGATTATTATCTTCCTCACAATTGCCTACCTGAAATTGTTGTTTCTTA
AAAAGTATTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR209819 representing NM_011920
Red=Cloning site Green=Tags(s)

MSSSNDHVLVPMSQRNNNGLPRTNSRAVRTLAEGDVLSFHHITYRVKVKSGFLVRKTVEKEILSDINGIM
KPGLNAILGPTGGGKSSLLDVLAARKDPKGLSGDVLINGAPQPAHFKCCSGYVVQDDVVMGTLTVRENLQ
FSAALRLPTTMKNHEKNERINTIIKELGLEKVADSKVGTQFIRGISGGERKRTSIGMELITDPSILFLDE
PTTGLDSSTANAVLLLLKRMSKQGRTIIFSIHQPRYSIFKLFDSLTLLASGKLVFHGPAQKALEYFASAG
YHCEPYNNPADFFLDVINGDSSAVMLNREEQDNEANKTEEPSKGEKPVIENLSEFYINSAIYGETKAELD
QLPGAQEKKGTSAFKEPVYVTSFCHQLRWIARRSFKNLLGNPQASVAQLIVTVILGLIIGAIYFDLKYDA
AGMQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFFGKVMSDLLPMRFLPSVIFT
CVLYFMLGLKKTVDAFFIMMFTLIMVAYTASSMALAIATGQSVVSVATLLMTIAFVFMMLFSGLLVNLRT
IGPWLSWLQYFSIPRYGFTALQYNEFLGQEFCPGFNVTDNSTCVNSYAICTGNEYLINQGIELSPWGLWK
NHVALACMIIIFLTIAYLKLLFLKKYS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_011920
ORF Size 1971 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_011920.1, NM_011920.2, NM_011920.3, NP_036050
RefSeq Size 2493
RefSeq ORF 1974
Locus ID 26357
Cytogenetics 6 B3|6 27.82 cM
MW 73.5 kDa
Gene Summary The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, the human protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. This protein likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations