Abcg2 (NM_011920) Mouse Tagged ORF Clone

CAT#: MR209819

Reviews ()
Write a review
  • TrueORF®

Abcg2 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family G (WHITE), member 2 (Abcg2)



  "NM_011920" in other vectors (6)

Interest in protein/lysate? Submit request here!

USD 480.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Abcg2 (NM_011920) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Abcg2
Synonyms ABC15; ABCP; AI428558; BCRP; Bcrp1; MXR; MXR1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR209819 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTCCAGTAATGACCACGTGTTAGTACCAATGTCGCAGAGAAACAACAACGGCCTTCCTAGGACGA
ACTCCAGAGCCGTTAGGACGCTCGCAGAAGGAGATGTGTTGAGTTTTCATCACATCACCTATCGAGTGAA
AGTAAAGAGTGGGTTTCTAGTCCGGAAAACAGTTGAGAAAGAAATACTATCAGATATCAATGGGATCATG
AAACCTGGCCTTAATGCTATTCTGGGACCCACAGGCGGAGGCAAGTCTTCGTTGCTAGATGTCTTAGCAG
CAAGGAAAGATCCAAAGGGATTATCTGGAGATGTTTTGATAAATGGAGCACCTCAACCTGCCCACTTCAA
ATGCTGTTCAGGTTATGTGGTTCAAGATGACGTTGTGATGGGCACCCTGACAGTGAGAGAAAACTTACAG
TTCTCAGCAGCTCTTCGACTTCCAACAACTATGAAGAATCATGAAAAAAATGAACGGATTAACACAATCA
TTAAAGAGTTAGGTCTGGAAAAAGTAGCAGATTCTAAGGTCGGAACTCAGTTTATCCGTGGCATCTCTGG
AGGAGAAAGAAAAAGGACAAGCATAGGGATGGAGCTGATCACTGACCCTTCCATCCTCTTCCTGGATGAG
CCCACGACTGGTTTGGACTCAAGCACAGCGAATGCTGTCCTTTTGCTCCTGAAAAGGATGTCTAAACAGG
GTCGAACAATCATCTTCTCCATTCATCAGCCTCGGTATTCCATCTTTAAGCTGTTTGACAGCCTCACCTT
ACTGGCTTCCGGGAAACTCGTGTTCCATGGGCCAGCACAGAAGGCCTTGGAGTACTTTGCATCAGCAGGT
TACCACTGTGAGCCCTACAACAACCCTGCGGATTTTTTCCTTGATGTCATCAATGGAGATTCTTCTGCTG
TGATGTTAAATAGAGAGGAACAAGACAATGAAGCAAACAAGACTGAAGAGCCTTCCAAGGGAGAGAAGCC
AGTAATAGAAAATTTATCTGAGTTTTATATCAACTCTGCCATCTATGGAGAAACAAAAGCTGAATTAGAT
CAACTTCCAGGAGCTCAGGAAAAGAAAGGAACATCGGCCTTCAAAGAGCCAGTCTATGTTACCTCTTTCT
GTCACCAGCTCCGATGGATTGCCAGGCGCTCATTTAAAAACTTGCTCGGGAACCCTCAAGCTTCTGTTGC
TCAGTTAATTGTTACAGTCATACTGGGGCTTATTATTGGTGCCATTTACTTTGATCTGAAATATGATGCC
GCTGGAATGCAAAATAGAGCTGGAGTTTTGTTTTTCCTGACTACCAACCAGTGTTTTTCCAGTGTGTCAG
CTGTGGAGCTGTTCGTAGTGGAGAAGAAACTCTTCATACATGAGTACATCAGTGGATATTACAGAGTGTC
TTCTTACTTCTTTGGAAAGGTGATGTCTGATTTACTCCCCATGAGGTTCTTGCCAAGTGTTATATTCACT
TGTGTATTATACTTCATGTTAGGACTGAAGAAGACGGTGGATGCTTTTTTCATCATGATGTTTACCCTTA
TAATGGTGGCTTATACGGCCAGTTCCATGGCACTGGCCATAGCCACAGGCCAAAGTGTGGTGTCTGTAGC
AACACTTCTCATGACAATCGCTTTTGTATTTATGATGCTCTTTTCTGGCCTCTTGGTGAATCTCAGAACC
ATTGGGCCTTGGCTGTCCTGGCTTCAGTACTTTAGCATTCCTCGATATGGCTTCACAGCTTTGCAGTATA
ATGAATTCTTGGGACAAGAGTTTTGTCCAGGATTCAATGTAACGGACAACAGCACTTGTGTTAACAGCTA
TGCAATATGTACTGGTAACGAGTACTTGATAAATCAGGGCATCGAACTGTCACCTTGGGGACTGTGGAAG
AATCATGTGGCCCTGGCTTGTATGATTATTATCTTCCTCACAATTGCCTACCTGAAATTGTTGTTTCTTA
AAAAGTATTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR209819 protein sequence
Red=Cloning site Green=Tags(s)

MSSSNDHVLVPMSQRNNNGLPRTNSRAVRTLAEGDVLSFHHITYRVKVKSGFLVRKTVEKEILSDINGIM
KPGLNAILGPTGGGKSSLLDVLAARKDPKGLSGDVLINGAPQPAHFKCCSGYVVQDDVVMGTLTVRENLQ
FSAALRLPTTMKNHEKNERINTIIKELGLEKVADSKVGTQFIRGISGGERKRTSIGMELITDPSILFLDE
PTTGLDSSTANAVLLLLKRMSKQGRTIIFSIHQPRYSIFKLFDSLTLLASGKLVFHGPAQKALEYFASAG
YHCEPYNNPADFFLDVINGDSSAVMLNREEQDNEANKTEEPSKGEKPVIENLSEFYINSAIYGETKAELD
QLPGAQEKKGTSAFKEPVYVTSFCHQLRWIARRSFKNLLGNPQASVAQLIVTVILGLIIGAIYFDLKYDA
AGMQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFFGKVMSDLLPMRFLPSVIFT
CVLYFMLGLKKTVDAFFIMMFTLIMVAYTASSMALAIATGQSVVSVATLLMTIAFVFMMLFSGLLVNLRT
IGPWLSWLQYFSIPRYGFTALQYNEFLGQEFCPGFNVTDNSTCVNSYAICTGNEYLINQGIELSPWGLWK
NHVALACMIIIFLTIAYLKLLFLKKYS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_011920
ORF Size 1974 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_011920.1, NM_011920.2, NM_011920.3, NP_036050.1
RefSeq Size 2493 bp
RefSeq ORF 1974 bp
Locus ID 26357
Cytogenetics 6 27.82 cM
MW 73 kDa
Gene Summary The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, the human protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. This protein likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "Abcg2"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools