Foxc1 (NM_008592) Mouse Tagged ORF Clone

CAT#: MR208772

  • TrueORF®

Foxc1 (Myc-DDK-tagged) - Mouse forkhead box C1 (Foxc1)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_008592" in other vectors (6)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 772.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Foxc1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Foxc1
Synonyms ch; fkh-1; Fkh1; FREAC3; frkhda; Mf1; Mf4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR208772 representing NM_008592
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGCGCGCTACTCGGTGTCCAGCCCCAACTCCCTGGGAGTGGTGCCCTACCTCGGCGGCGAGCAGA
GCTACTATCGCGCTGCCGCGGCGGCGGCCGGGGGCGGCTACACCGCCATGCCGGCCCCTATGAGCGTGTA
CTCGCACCCTGCTCACGCCGAGCAGTACCCGGGCAGCATGGCGCGCGCCTACGGGCCTTATACGCCGCAG
CCGCAGCCCAAGGACATGGTGAAGCCGCCCTACAGCTACATCGCTCTTATCACCATGGCCATCCAGAATG
CCCCGGACAAGAAGATCACTCTGAATGGCATCTACCAGTTCATCATGGACCGCTTCCCCTTCTATCGGGA
CAATAAGCAGGGCTGGCAGAACAGCATACGGCACAACCTCTCGCTCAACGAGTGCTTCGTCAAGGTGCCC
CGCGACGACAAGAAGCCAGGCAAGGGCAGCTACTGGACGCTCGACCCGGACTCCTACAACATGTTCGAGA
ACGGCAGCTTCCTGCGGCGGCGGCGGCGCTTCAAGAAGAAGGACGCAGTGAAGGACAAGGAGGAGAAGGG
CCGGCTGCACCTCCAAGAACCGCCACCGCCGCAGGCCGGCCGCCAGCCCGCGCCCGCGCCCCCGGAGCAG
GCCGAGGGCTCCGCTCCCGGGCCACAGCCGCCGCCCGTGCGCATCCAGGACATCAAGACGGAGAACGGTA
CGTGTCCCTCGCCTCCCCAGCCCCTGTCCCCGGCTGCCGCCCTAGGCAGCGGCAGCGCCGCCACAGTGCC
CAAAATCGAGAGCCCCGACAGCAGCAGCAGCAGCTTGTCGAGCGGGAGCAGCCCCCCGGGCAGCCTGCCG
TCGGCGCGGCCGCTCAGCCTGGACGCTGCAGAACCCGCGCCGCCGCCACAGCCTGCGCCGCCGCCGCATC
ACAGCCAGGGCTTCAGCGTGGACAACATCATGACGTCGCTGCGGGGGTCGCCGCAGGGTTCGGCCGCTGA
GCTCGGTTCCGGCCTCCTGGCCTCGGCGGCTGCGTCCTCGCGCGCGGGCATCGCGCCCCCGCTGGCGCTG
GGTGCCTACTCTCCGGGCCAGAGCTCCCTCTACAGCTCCCCCTGCAGCCAGAGCTCCAGTGCGGGCAGTT
CGGGCGGCGGGGGTGGCGGCGGCGGCGGAGGCGGCGGCAGCAGCAGCGCTGCGGGTACGGGGGGCGCCGC
CACTTACCACTGCAACCTGCAGGCTATGAGCCTGTACGCGGCGGGCGAGCGTGGCGGCCACTTGCAGGGT
CCGGCGGGAGGCGCGGGCAGCGCGGCGGTGGACGACCCCCTGCCCGACTACTCGCTGCCTCCAGCGACCA
GCAGCAGCTCTTCGTCCCTGAGTCATGGCGGGGGCGGCCAGGAGGCCAGCCACCACCCTGCATCCCACCA
GGGCCGACTCACCTCGTGGTACCTGAACCAGGCAGGTGGAGACCTGGGCCACTTGGCGAGCGCGGCGGCG
GCTGCGGCGGCCGCAGGCTACCCTGGCCAGCAGCAGAACTTCCACTCGGTGCGGGAAATGTTCGAGTCTC
AGCGGATCGGCTTGAACAACTCCCCGGTGAATGGGAATAGTAGCTGTCAGATGGCTTTCCCTGCCAGTCA
GTCTCTGTACCGCACGTCGGGGGCTTTCGTCTATGACTGTAGCAAATTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR208772 representing NM_008592
Red=Cloning site Green=Tags(s)

MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGSMARAYGPYTPQ
PQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVP
RDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKGRLHLQEPPPPQAGRQPAPAPPEQ
AEGSAPGPQPPPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAATVPKIESPDSSSSSLSSGSSPPGSLP
SARPLSLDAAEPAPPPQPAPPPHHSQGFSVDNIMTSLRGSPQGSAAELGSGLLASAAASSRAGIAPPLAL
GAYSPGQSSLYSSPCSQSSSAGSSGGGGGGGGGGGGSSSAAGTGGAATYHCNLQAMSLYAAGERGGHLQG
PAGGAGSAAVDDPLPDYSLPPATSSSSSSLSHGGGGQEASHHPASHQGRLTSWYLNQAGGDLGHLASAAA
AAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPASQSLYRTSGAFVYDCSKF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_008592
ORF Size 1659 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_008592.2, NP_032618.2
RefSeq Size 3990 bp
RefSeq ORF 1662 bp
Locus ID 17300
UniProt ID Q61572
Cytogenetics 13 13.52 cM
MW 57.4 kDa
Gene Summary DNA-binding transcriptional factor that plays a role in a broad range of cellular and developmental processes such as eye, bones, cardiovascular, kidney and skin development (PubMed:9635428, PubMed:9106663, PubMed:10479458, PubMed:10395790, PubMed:11562355, PubMed:18187037, PubMed:19668217, PubMed:22493429, PubMed:24590069, PubMed:25808752, PubMed:28223138). Acts either as a transcriptional activator or repressor (PubMed:28223138). Binds to the consensus binding site 5'-[G/C][A/T]AAA[T/C]AA[A/C]-3' in promoter of target genes (PubMed:25808752). Upon DNA-binding, promotes DNA bending. Acts as a transcriptional coactivator (PubMed:25808752). Stimulates Indian hedgehog (Ihh)-induced target gene expression mediated by the transcription factor GLI2, and hence regulates endochondral ossification (PubMed:25808752). Acts also as a transcriptional coregulator by increasing DNA-binding capacity of GLI2 in breast cancer cells. Regulates FOXO1 through binding to a conserved element, 5'-GTAAACAAA-3' in its promoter region, implicating FOXC1 as an important regulator of cell viability and resistance to oxidative stress in the eye (By similarity). Cooperates with transcription factor FOXC2 in regulating expression of genes that maintain podocyte integrity (PubMed:28223138). Promotes cell growth inhibition by stopping the cell cycle in the G1 phase through TGFB1-mediated signals. Involved in epithelial-mesenchymal transition (EMT) induction by increasing cell proliferation, migration and invasion (By similarity). Involved in chemokine CXCL12-induced endothelial cell migration through the control of CXCR4 expression (PubMed:18187037). Plays a role in the gene regulatory network essential for epidermal keratinocyte terminal differentiation (By similarity). Essential developmental transcriptional factor required for mesoderm-derived tissues formation, such as the somites, skin, bone and cartilage (PubMed:9106663, PubMed:10479458, PubMed:10395790, PubMed:10704385, PubMed:11562355, PubMed:15196959). Positively regulates CXCL12 and stem cell factor expression in bone marrow mesenchymal progenitor cells, and hence plays a role in the development and maintenance of mesenchymal niches for haematopoietic stem and progenitor cells (HSPC) (PubMed:24590069). Plays a role in corneal transparency by preventing both blood vessel and lymphatic vessel growth during embryonic development in a VEGF-dependent manner (PubMed:22171010). May function as a tumor suppressor (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.