Cdc42ep1 (NM_027219) Mouse Tagged ORF Clone

CAT#: MR206427

Cdc42ep1 (Myc-DDK-tagged) - Mouse CDC42 effector protein (Rho GTPase binding) 1 (Cdc42ep1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 219.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cdc42ep1 (NM_027219) Mouse Tagged ORF Clone
Symbol Cdc42ep1
Synonyms 1810058K22Rik; AA980734; Borg5; CEP1; MSE55
Vector pCMV6-Entry
Sequence Data
>MR206427 representing NM_027219
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCGGTCCCCAGGGGGGCACAGGAGCCCCCACCATGAGCCTGGGCAAGCTGTCTCCTGTGGGATGGG
TGTCCAGTTCCCATGGAAAGAGACGCCTGACAGCAGACATGATCAGCCCCCCACTTGGGGACTTCCGCCA
CACCATGCACGTAGGCCGTGGTGGGGATGTCTTCGGAGATACGTCCTTCCTCAGCAACCACGGAGGCCGC
TCTGGAAACACCCACCGCTCACCCCGAAGTTTCCTGGCCAGGAAGCTCCAACAGGTTCGCAGAGTCGGGG
TGCCACCTCGAAGGATGGCTTCCCCGGCTGCACCATCACCTGCTCCGCCTCCCATCTCGCCCATCATCAA
GAACGCCATCTCCCTGCCTCAGCTCAACCAGGCCACCTATGACAGTCTGGTGATGGGCAAGCTTAGTTTT
GACAGCACGCCGGCTAGCTCCACAGATGGCCACTCTGGTTACGGCCTGGAGTCTGGCTTCTGTACCATCT
CACGCCTGCCACGCGTGGAAAAGCACAGCAACCGTGACCGTGACCGTGACCCGGACCATTCTCAAGACCG
AGAGCAAAGTTCTTTCCCCTCTGAGCCTACCCCTAACCCTGAGCTCCGACGCTCTGACTCTCTCTTGTCC
TTCCGTTTTGACCTTGACCTTGGGCCCTCACTCCTCAGTGAGCTGCTAGGGGTCATGAGCCTTTCAGAAG
CTCCAGCTGCTGAAACTCCAGTCCCTACTGCCAACCCCCCTGCTCCTGCAGCAAACCCTGCCCCTACTGC
AAAACCCCCAGCCCATGCGATAACCACTCTAGATGCTGTGACAAGCCTTCCAGCCTCTGCTGTGACAAGC
CTTCCAGCCCCTGCGGCGGCAAGCTCCCCATCCCGTGGACATTTCCCCAATGGGGTAACTTCTGTGTTGG
GCCCTGCGGCTGAGGCAAAGCCCAGTCCTGTGGGAGAGGGTCCCCAGGTACCCTCCAACATGACCTTTGA
CAGGCATGGAGCCAGCTGGGGGGCCAGCCGGGCCAGCTGGGGGGCCAGCCGGGCCAGCCGCCACTACACT
GAGATGGATGCCCGGCGGGAGCTGGCAGGGGTGTTACCCCAAGTTCATGGCTCCTGGGAGAGTCTGAATG
AAGACTGGAGCACGCCTCCAGCCAGTGTCAGGGCTCCTGTGCCCACCTCGGTGCAGGTCAATGCCTTTGA
GTTTGCTGATGCTGAGGAAGATGACGAGGTCAAGGTG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>MR206427 representing NM_027219
Red=Cloning site Green=Tags(s)

MPGPQGGTGAPTMSLGKLSPVGWVSSSHGKRRLTADMISPPLGDFRHTMHVGRGGDVFGDTSFLSNHGGR
SGNTHRSPRSFLARKLQQVRRVGVPPRRMASPAAPSPAPPPISPIIKNAISLPQLNQATYDSLVMGKLSF
DSTPASSTDGHSGYGLESGFCTISRLPRVEKHSNRDRDRDPDHSQDREQSSFPSEPTPNPELRRSDSLLS
FRFDLDLGPSLLSELLGVMSLSEAPAAETPVPTANPPAPAANPAPTAKPPAHAITTLDAVTSLPASAVTS
LPAPAAASSPSRGHFPNGVTSVLGPAAEAKPSPVGEGPQVPSNMTFDRHGASWGASRASWGASRASRHYT
EMDARRELAGVLPQVHGSWESLNEDWSTPPASVRAPVPTSVQVNAFEFADAEEDDEVKV

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_027219
ORF Size 1227 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_027219.1, NM_027219.2, NM_027219.3, NP_081495
RefSeq Size 2543
RefSeq ORF 1230
Locus ID 104445
Cytogenetics 15|15 E1
MW 43.5 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)